![Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Western blot analysis of extracts of various cell lines, using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/UBE2I-Ubc9-Antibody-6Z9V6-Western-Blot-NBP3-16400-img0004.jpg "Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Western blot analysis of extracts of various cell lines, using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 6Z9V6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2I/Ubc9 (P63279). MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEED |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | UBE2I |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for UBE2I/Ubc9 Antibody (NBP3-16400)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UBE2I |
![Immunohistochemistry-Paraffin: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry of paraffin-embedded mouse spinal cord using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/UBE2I-Ubc9-Antibody-6Z9V6-Immunohistochemistry-Paraffin-NBP3-16400-img0003.jpg "Immunohistochemistry-Paraffin: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry of paraffin-embedded mouse spinal cord using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Western blot analysis of extracts of HeLa cells, using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/UBE2I-Ubc9-Antibody-6Z9V6-Western-Blot-NBP3-16400-img0005.jpg "Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Western blot analysis of extracts of HeLa cells, using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
![Immunohistochemistry-Paraffin: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry of paraffin-embedded rat brain using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/UBE2I-Ubc9-Antibody-6Z9V6-Immunohistochemistry-Paraffin-NBP3-16400-img0001.jpg "Immunohistochemistry-Paraffin: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry of paraffin-embedded rat brain using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry of paraffin-embedded human colon carcinoma using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/UBE2I-Ubc9-Antibody-6Z9V6-Immunohistochemistry-Paraffin-NBP3-16400-img0002.jpg "Immunohistochemistry-Paraffin: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry of paraffin-embedded human colon carcinoma using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")