![Western Blot: TLX3 Antibody (2A3) [H00030012-M01] - TLX3 monoclonal antibody (M01), clone 2A3 Analysis of TLX3 expression in MCF-7.](http://images.novusbio.com/fullsize/TLX3-Antibody-2A3-Western-Blot-H00030012-M01-img0007.jpg "Western Blot: TLX3 Antibody (2A3) [H00030012-M01] - TLX3 monoclonal antibody (M01), clone 2A3 Analysis of TLX3 expression in MCF-7.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, KD |
| Clone | 2A3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | TLX3 (NP_066305, 192 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV |
| Specificity | TLX3 - T-cell leukemia homeobox 3 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TLX3 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: TLX3 Antibody (2A3) [H00030012-M01] - Analysis of TLX3 over-expressed 293 cell line, cotransfected with TLX3 Validated Chimera RNAi ( Cat # H00030012-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TLX3 monoclonal antibody (M01), clone 2A3 (Cat # H00030012-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/TLX3-Antibody-2A3-Western-Blot-H00030012-M01-img0005.jpg "Western Blot: TLX3 Antibody (2A3) [H00030012-M01] - Analysis of TLX3 over-expressed 293 cell line, cotransfected with TLX3 Validated Chimera RNAi ( Cat # H00030012-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TLX3 monoclonal antibody (M01), clone 2A3 (Cat # H00030012-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: TLX3 Antibody (2A3) [H00030012-M01] - Analysis of TLX3 expression in transfected 293T cell line by TLX3 monoclonal antibody (M01), clone 2A3.Lane 1: TLX3 transfected lysate(31.9 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TLX3-Antibody-2A3-Western-Blot-H00030012-M01-img0008.jpg "Western Blot: TLX3 Antibody (2A3) [H00030012-M01] - Analysis of TLX3 expression in transfected 293T cell line by TLX3 monoclonal antibody (M01), clone 2A3.Lane 1: TLX3 transfected lysate(31.9 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: TLX3 Antibody (2A3) [H00030012-M01] - Detection limit for recombinant GST tagged TLX3 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TLX3-Antibody-2A3-Sandwich-ELISA-H00030012-M01-img0006.jpg "Sandwich ELISA: TLX3 Antibody (2A3) [H00030012-M01] - Detection limit for recombinant GST tagged TLX3 is approximately 0.03ng/ml as a capture antibody.")
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![Immunocytochemistry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Immunocytochemistry_10616.jpg)
![Flow Cytometry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Flow_Cytometry_22133.jpg)
![Flow Cytometry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Flow_Cytometry_22134.jpg)
![N/A CD46 Antibody (344519) [Unconjugated]](https://images.novusbio.com/images/antibody/mab2005_human-cd46-mab-clone-344519-209202413163..jpg)
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")