Home » ST2/IL-33R » ST2/IL-33R Proteins » ST2/IL-33R Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ST2/IL-33R Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ST2/IL-33R Recombinant Protein Antigen (NBP1-85252PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ST2/IL-33R Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL1RL1.

Source: E. coli

Amino Acid Sequence: PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL1RL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85252.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ST2/IL-33R Recombinant Protein Antigen

  • DER4
  • DER4ST2growth stimulation-expressed
  • Fit-1
  • IL-1 R4
  • IL1R4
  • IL-1R4
  • IL-1RL1
  • IL-33 R
  • IL33R
  • IL-33R
  • interleukin 1 receptor-like 1
  • interleukin 1 receptor-related protein
  • interleukin-1 receptor-like 1
  • Ly84
  • MGC32623
  • Protein ST2
  • ST2
  • ST2L
  • ST2V
  • T1
  • T1homolog of mouse growth stimulation-expressed

Background

The protein encoded by the IL1RL1 gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-33 Antibody
[Unconjugated]
AF3626
Western Blot IL-33 Antibody [Unconjugated]
Neutralization IL-33 Antibody [Unconjugated]
Immunohistochemistry IL-33 Antibody [Unconjugated]
(2 Reviews)
(142 Publications)
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, ICFlow, Neut, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(815 Publications)
Species: Hu
Applications: BA
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]
Bioactivity IL-1 beta/IL-1F2 [Unconjugated]
SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]
(594 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
IL-5 [HRP]
M5000
N/A IL-5 [HRP]
N/A IL-5 [HRP]
(92 Publications)
Species: Mu
Applications: ELISA
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(148 Publications)
Species: Mu
Applications: ELISA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(301 Publications)
Species: Mu
Applications: ELISA
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(140 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
IL-1 RAcP/IL-1 R3
Antibody [Unconjugate ...
AF676
Flow Cytometry IL-1 RAcP/IL-1 R3 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(453 Publications)
Species: Hu
Applications: BA

TRANCE/TNFSF11/RANK L
462-TEC
SDS-PAGE TRANCE/TNFSF11/RANK L [Unconjugated]
Bioactivity TRANCE/TNFSF11/RANK L [Unconjugated]
(90 Publications)
Species: Mu
Applications: BA
IL-18/IL-1F4 [HRP]
7625
IL-18/IL-1F4 [HRP]
(54 Publications)
Species: Mu
Applications: ELISA
GM-CSF
[Unconjugated]
7954-GM/CF
Bioactivity GM-CSF [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin Insulin Receptor beta Antibody
Immunoprecipitation Insulin Receptor beta Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
ST2/IL-33R
Recombinant Protein A
NBP1-85252PEP
ST2/IL-33R Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ST2/IL-33R Recombinant Protein Antigen (NBP1-85252PEP) (0)

There are no publications for ST2/IL-33R Recombinant Protein Antigen (NBP1-85252PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST2/IL-33R Recombinant Protein Antigen (NBP1-85252PEP) (0)

There are no reviews for ST2/IL-33R Recombinant Protein Antigen (NBP1-85252PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ST2/IL-33R Recombinant Protein Antigen (NBP1-85252PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ST2/IL-33R Products

Research Areas for ST2/IL-33R Recombinant Protein Antigen (NBP1-85252PEP)

Find related products by research area.

Blogs on ST2/IL-33R

There are no specific blogs for ST2/IL-33R, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ST2/IL-33R Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol IL1RL1