![Western Blot: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Western-Blot-NBP1-92436-img0005.jpg "Western Blot: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SGMS2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SGMS2 |
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Analysis in human gallbladder and skeletal muscle tissues. Corresponding SGMS2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0011.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Analysis in human gallbladder and skeletal muscle tissues. Corresponding SGMS2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human gallbladder shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0006.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human gallbladder shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human skeletal muscle shows weak positivity in myocytes.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0007.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human skeletal muscle shows weak positivity in myocytes.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human Fallopian tube shows weak membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0008.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human Fallopian tube shows weak membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human small intestine shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0009.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human small intestine shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human lung shows moderate membranous positivity in pneumocytes.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0010.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human lung shows moderate membranous positivity in pneumocytes.")
![Immunohistochemistry Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Immunohistochemistry_11019.jpg)
![Western Blot Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Western_Blot_11065.jpg)
![Knockout Validated Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Knockout_Validated_23118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot SMPD3/NSMase2 Antibody (758612) [Unconjugated]](https://images.novusbio.com/images2/SMPD3_MAB7184_Western_Blot_12188.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")