![Western Blot: SP4 Antibody [NBP2-83576] - WB Suggested Anti-SP4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate](http://images.novusbio.com/fullsize/SP4-Antibody-Western-Blot-NBP2-83576-img0002.jpg "Western Blot: SP4 Antibody [NBP2-83576] - WB Suggested Anti-SP4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SP4. Peptide sequence: GGTALAIVTSGELDSSVTEVLGSPRIVTVAAISQDSNPATPNVSTNMEEF The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SP4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunocytochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunocytochemistry__Immunofluorescence_21675.jpg)
![Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunohistochemistry_6763.jpg)
![Knockout Validated HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Knockout_Validated_22522.jpg)
![Neutralization VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Block_Neutralize_1519.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_22159.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_6888.jpg)
Secondary Antibodies |
Isotype Controls |
|
Nur77 Activation and Tumor Suppression Nur77 is a member of the steroid/thyroid hormone phosphoprotein receptor superfamily. It is heavily post-translationally modified and rapidly induced in response to androgens and growth factors. It governs fundamental processes such as cell proliferat... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SP4 |
![Immunohistochemistry: SP4 Antibody [NBP2-83576] - Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-SP4 antibody](http://images.novusbio.com/fullsize/SP4-Antibody-Immunohistochemistry-NBP2-83576-img0001.jpg "Immunohistochemistry: SP4 Antibody [NBP2-83576] - Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-SP4 antibody")
![COCO/DAND5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "COCO/DAND5 [Unconjugated]")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunohistochemistry VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R1_AF321_Immunohistochemistry_6778.jpg)
![Immunohistochemistry VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R1_AF321_Immunohistochemistry_9337.jpg)
![Western Blot VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af321_human-vegf-r1-flt-1-affinity-purified-polyclonal-ab-8220249511449.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")