![Western Blot: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Western blot analysis of extracts of Mouse thymus, using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-6H8I7-Western-Blot-NBP3-16216-img0005.jpg "Western Blot: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Western blot analysis of extracts of Mouse thymus, using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clone | 6H8I7 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 953-1052 of human SMARCA5/SNF2H (O60264). RFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKLKL |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | SMARCA5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SMARCA5/SNF2H Antibody (NBP3-16216)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMARCA5 |
![Immunocytochemistry/Immunofluorescence: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Immunofluorescence analysis of U-2 OS cells using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-6H8I7-Immunocytochemistry-Immunofluorescence-NBP3-16216-img0003.jpg "Immunocytochemistry/Immunofluorescence: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Immunofluorescence analysis of U-2 OS cells using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Western blot analysis of extracts of various cell lines, using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-6H8I7-Western-Blot-NBP3-16216-img0004.jpg "Western Blot: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Western blot analysis of extracts of various cell lines, using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Immunocytochemistry/Immunofluorescence: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Immunofluorescence analysis of C6 cells using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-6H8I7-Immunocytochemistry-Immunofluorescence-NBP3-16216-img0001.jpg "Immunocytochemistry/Immunofluorescence: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Immunofluorescence analysis of C6 cells using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Immunofluorescence analysis of NIH-3T3 cells using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-6H8I7-Immunocytochemistry-Immunofluorescence-NBP3-16216-img0002.jpg "Immunocytochemistry/Immunofluorescence: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Immunofluorescence analysis of NIH-3T3 cells using SMARCA5/SMARCA5/SNF2H Rabbit mAb (NBP3-16216) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunoprecipitation: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug SMARCA5/SNF2H antibody (NBP3-16216). Western blot was performed from the immunoprecipitate using SMARCA5/SNF2H antibody (NBP3-16216) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-6H8I7-Immunoprecipitation-NBP3-16216-img0006.jpg "Immunoprecipitation: SMARCA5/SNF2H Antibody (6H8I7) [NBP3-16216] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug SMARCA5/SNF2H antibody (NBP3-16216). Western blot was performed from the immunoprecipitate using SMARCA5/SNF2H antibody (NBP3-16216) at a dilition of 1:1000.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")