| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human RNA Polymerase II/POLR2A Source: Wheat Germ (in vitro) Amino Acid Sequence: MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCV |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | POLR2A |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for RNA Polymerase II/POLR2A Partial Recombinant Protein (H00005430-Q01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | POLR2A |
![Immunohistochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunohistochemistry_10417.jpg)
![Immunocytochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunocytochemistry_11095.jpg)
![Western Blot Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Western_Blot_9601.jpg)
![Immunohistochemistry NOV/CCN3 Antibody [Unconjugated]](https://images.novusbio.com/images2/NOV_AF1640_Immunohistochemistry_7314.jpg)
![Flow Cytometry: RNA Polymerase II/POLR2A Antibody (4H8) [NB200-598] - An intracellular stain was performed on HeLa cells with RNA Polymerase II/POLR2A (4H8) antibody NB200-598PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to phycoerythrin.](https://images.novusbio.com/images/RNA-Polymerase-II-POLR2A-Antibody-4H8-Flow-Cytometry-NB200-598-img0013.jpg "Flow Cytometry: RNA Polymerase II/POLR2A Antibody (4H8) [NB200-598] - An intracellular stain was performed on HeLa cells with RNA Polymerase II/POLR2A (4H8) antibody NB200-598PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to phycoerythrin.")