Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR |
Marker | post-Synaptic Marker |
Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | DLG4 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-80875 | Applications | Species |
---|---|---|
Rementer, Cameron, C Engineered Myeloid Precursors Differentiate into Osteoclasts and Resorb Heterotopic Ossification in Mice Research Square 2022-11-07 (ICC/IF) | ICC/IF | |
Li, Jiaxin, J Self-healing hybrid hydrogels with sustained bioactive components release for guided bone regeneration Research Square 2022-11-29 [PMID: 36814282] (ICC/IF) | ICC/IF | |
Fourie C, Kim E, Waldvogel H et al. Differential Changes in Postsynaptic Density Proteins in Postmortem Huntingtons Disease and Parkinsons Disease Human Brains. J Neurodegener Dis 2014-01-01 [PMID: 26317010] (IF/IHC, WB, Human) | IF/IHC, WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for PSD-95 Antibody (NBP1-80875)Find related products by research area.
|
Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease By Jamshed Arslan Pharm.D. Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.