PIAS3 Recombinant Protein Antigen

Images

 
There are currently no images for PIAS3 Recombinant Protein Antigen (NBP2-48503PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIAS3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIAS3.

Source: E. coli

Amino Acid Sequence: PTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIAS3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48503.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIAS3 Recombinant Protein Antigen

  • MIZ-type containing 5
  • PIAS3
  • Protein inhibitor of activated STAT protein 3
  • protein inhibitor of activated STAT, 3
  • ZMIZ5

Background

PIAS3 encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
M6000B
Species: Mu
Applications: ELISA
NBP3-16858
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-1318
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-15676
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
MAB5696
Species: Hu, Mu
Applications: WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-77159
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF5769
Species: Hu
Applications: IHC, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NB100-781
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
E2-645
Species: Hu
Applications: EnzAct
NBP2-67429
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-48503PEP
Species: Hu
Applications: AC

Publications for PIAS3 Recombinant Protein Antigen (NBP2-48503PEP) (0)

There are no publications for PIAS3 Recombinant Protein Antigen (NBP2-48503PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIAS3 Recombinant Protein Antigen (NBP2-48503PEP) (0)

There are no reviews for PIAS3 Recombinant Protein Antigen (NBP2-48503PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIAS3 Recombinant Protein Antigen (NBP2-48503PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIAS3 Products

Research Areas for PIAS3 Recombinant Protein Antigen (NBP2-48503PEP)

Find related products by research area.

Blogs on PIAS3

There are no specific blogs for PIAS3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIAS3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIAS3