Home » OLFM4 » OLFM4 Proteins » OLFM4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

OLFM4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for OLFM4 Recombinant Protein Antigen (NBP2-62720PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

OLFM4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OLFM4.

Source: E. coli

Amino Acid Sequence: KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OLFM4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62720.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OLFM4 Recombinant Protein Antigen

  • Antiapoptotic protein GW112
  • bA209J19.1
  • GC1
  • G-CSF-stimulated clone 1 protein
  • GW112
  • GW112hOLfD
  • hGC-1
  • KIAA4294
  • olfactomedin 4
  • Olfactomedin-4
  • OlfD
  • OLFM4
  • OLM4
  • UNQ362

Background

OLFM4 (olfactomedin 4) was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. OLFM4 (olfactomedin 4) is a member of the olfactomedin related protein family. The exact function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

G-CSF Antibody
(67604) [Unconjugated
MAB414
Neutralization G-CSF Antibody (67604) [Unconjugated]
(60 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
SLC25A18 Antibody
NBP3-17540
Western Blot SLC25A18 Antibody
Immunocytochemistry/ Immunofluorescence SLC25A18 Antibody
Species: Hu
Applications: ICC/IF, WB
GCAP1 Antibody
NBP2-55158
Immunohistochemistry-Paraffin GCAP1 Antibody
Immunohistochemistry-Paraffin GCAP1 Antibody
Immunohistochemistry-Paraffin GCAP1 Antibody
(1 Publication)
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
GUCY2D Antibody
NBP3-12211
Immunohistochemistry-Paraffin GUCY2D Antibody
Unknown GUCY2D Antibody
Western Blot GUCY2D Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Reg4 Antibody
[Unconjugated]
AF1379
Immunohistochemistry Reg4 Antibody [Unconjugated]
(1 Review)
(9 Publications)
Species: Hu
Applications: IHC, WB
GRIM19 Antibody
NBP1-90050
Immunohistochemistry-Paraffin GRIM19 Antibody
Immunohistochemistry-Paraffin GRIM19 Antibody
Immunohistochemistry-Paraffin GRIM19 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GCAP2 Antibody
NBP2-68721
Western Blot GCAP2 Antibody
Immunohistochemistry-Paraffin GCAP2 Antibody
(1 Publication)
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
G-CSF Antibody
(67604) [Unconjugated
MAB414
Neutralization G-CSF Antibody (67604) [Unconjugated]
(60 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(834 Publications)
Species: Hu
Applications: BA
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
(2 Reviews)
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
CEACAM7 Antibody
[Unconjugated]
AF4478
Immunohistochemistry CEACAM7 Antibody [Unconjugated]
Western Blot CEACAM7 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Neurofascin
Antibody
AF3235
Western Blot Neurofascin Antibody
Immunohistochemistry Neurofascin Antibody
(1 Review)
(32 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for OLFM4 Recombinant Protein Antigen (NBP2-62720PEP) (0)

There are no publications for OLFM4 Recombinant Protein Antigen (NBP2-62720PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OLFM4 Recombinant Protein Antigen (NBP2-62720PEP) (0)

There are no reviews for OLFM4 Recombinant Protein Antigen (NBP2-62720PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OLFM4 Recombinant Protein Antigen (NBP2-62720PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OLFM4 Products

Research Areas for OLFM4 Recombinant Protein Antigen (NBP2-62720PEP)

Find related products by research area.

Blogs on OLFM4

There are no specific blogs for OLFM4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OLFM4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol OLFM4