NDUFAF3 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal of Human NDUF3. Peptide sequence: LPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMINGN The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NDUFAF3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for NDUFAF3 Antibody
Background
NDUFAF3 encodes a nuclear protein of unknown function. The similar rat nuclear protein is predominantly expressed in testis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]. Transcript Variant: This variant (5) contains an in-frame segment of the coding region, and uses a downstream start codon, compared to variant 1. Isoform b has a shorter N-terminus, compared to isoform a. Variants 2, 3, 4 and 5 encode the same isoform (b).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for NDUFAF3 Antibody (NBP2-85369) (0)
There are no publications for NDUFAF3 Antibody (NBP2-85369).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NDUFAF3 Antibody (NBP2-85369) (0)
There are no reviews for NDUFAF3 Antibody (NBP2-85369).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NDUFAF3 Antibody (NBP2-85369) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NDUFAF3 Products
Blogs on NDUFAF3