![Immunocytochemistry/Immunofluorescence: NCAPG2 Antibody [NBP1-86633] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NCAPG2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86633-img0007.jpg "Immunocytochemistry/Immunofluorescence: NCAPG2 Antibody [NBP1-86633] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NCAPG2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Theoretical MW | 131 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human tonsil shows moderate nuclear positivity in germinal center and non-germinal center cells.](http://images.novusbio.com/fullsize/NCAPG2-Antibody-Immunohistochemistry-Paraffin-NBP1-86633-img0005.jpg "Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human tonsil shows moderate nuclear positivity in germinal center and non-germinal center cells.")
![Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and Leydig cells.](http://images.novusbio.com/fullsize/NCAPG2-Antibody-Immunohistochemistry-Paraffin-NBP1-86633-img0003.jpg "Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and Leydig cells.")
![Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/NCAPG2-Antibody-Immunohistochemistry-Paraffin-NBP1-86633-img0004.jpg "Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human prostate shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human skeletal muscle shows weak to moderate nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/NCAPG2-Antibody-Immunohistochemistry-Paraffin-NBP1-86633-img0006.jpg "Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human skeletal muscle shows weak to moderate nuclear positivity in myocytes.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")