![Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Analysis in human small intestine and skeletal muscle tissues using NBP1-87244 antibody. Corresponding NAPRT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NAPRT1-Antibody-Immunohistochemistry-Paraffin-NBP1-87244-img0017.jpg "Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Analysis in human small intestine and skeletal muscle tissues using NBP1-87244 antibody. Corresponding NAPRT RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, ChHa, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NAPRT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
![Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]](https://images.novusbio.com/images2/Endoglin_AF1320_Immunocytochemistry_7258.jpg)
![Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]](https://images.novusbio.com/images2/Endoglin_AF1320_Immunocytochemistry_12779.jpg)
![Simple Western Endoglin/CD105 Antibody [Unconjugated]](https://images.novusbio.com/images2/Endoglin_AF1320_Simple_Western_18976.jpg)
| Publication using NBP1-87244 | Applications | Species |
|---|---|---|
| Xiao Y, Elkins K, Durieux JK et al. Dependence of Tumor Cell Lines and Patient-Derived Tumors on the NAD Salvage Pathway Renders Them Sensitive to NAMPT Inhibition with GNE-618. Neoplasia 2013-10-01 [PMID: 24204194] (WB, Mouse, Chinese Hamster, Human) | WB | Mouse, Chinese Hamster, Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Shinichi Oka |
KD | Rat | 11/28/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for NAPRT1 Antibody (NBP1-87244)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human colon, kidney, lymph node and urinary bladder using Anti-NAPRT antibody NBP1-87244 (A) shows similar protein distribution across tissues to independent antibody NBP1-87243 (B).](http://images.novusbio.com/fullsize/NAPRT1-Antibody-Immunohistochemistry-Paraffin-NBP1-87244-img0010.jpg "Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human colon, kidney, lymph node and urinary bladder using Anti-NAPRT antibody NBP1-87244 (A) shows similar protein distribution across tissues to independent antibody NBP1-87243 (B).")
![Western Blot: NAPRT1 Antibody [NBP1-87244] - Analysis using Anti-NAPRT antibody NBP1-87244 (A) shows similar pattern to independent antibody NBP1-87243 (B).](http://images.novusbio.com/fullsize/NAPRT1-Antibody-Western-Blot-NBP1-87244-img0011.jpg "Western Blot: NAPRT1 Antibody [NBP1-87244] - Analysis using Anti-NAPRT antibody NBP1-87244 (A) shows similar pattern to independent antibody NBP1-87243 (B).")
![Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/NAPRT1-Antibody-Immunohistochemistry-Paraffin-NBP1-87244-img0021.jpg "Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NAPRT1-Antibody-Immunohistochemistry-Paraffin-NBP1-87244-img0018.jpg "Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/NAPRT1-Antibody-Immunohistochemistry-Paraffin-NBP1-87244-img0019.jpg "Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human placenta shows moderate cytoplasmic positivity in tropoblastic cells.](http://images.novusbio.com/fullsize/NAPRT1-Antibody-Immunohistochemistry-Paraffin-NBP1-87244-img0020.jpg "Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human placenta shows moderate cytoplasmic positivity in tropoblastic cells.")
![Knockdown Validated: Rabbit Polyclonal NAPRT1 Antibody [NBP1-87244] - Immunoblot using primary cultured rat cardiomyocyte with NAPRT1 knockdown using the siRNA. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-87244_rabbit-polyclonal-naprt1-antibody-knockdown-validated-20122023112954.png "Knockdown Validated: Rabbit Polyclonal NAPRT1 Antibody [NBP1-87244] - Immunoblot using primary cultured rat cardiomyocyte with NAPRT1 knockdown using the siRNA. Image from a verified customer review.")
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
