Home » NAPG » NAPG Proteins » NAPG Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NAPG Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NAPG Protein (NBP1-86101PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NAPG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAPG.

Source: E. coli

Amino Acid Sequence: HLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NAPG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86101.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NAPG Recombinant Protein Antigen

  • gamma SNAP
  • GAMMASNAP
  • gamma-soluble NSF attachment protein
  • N-ethylmaleimide-sensitive factor attachment protein gamma
  • N-ethylmaleimide-sensitive factor attachment protein, gamma
  • SNAPG
  • SNAP-gamma
  • soluble NSF attachment protein

Background

NSF and SNAPs are general elements of the cellular membrane transport apparatus. The sequence of the predicted 312-amino acid human protein encoded by NAPG is 95% identical to that of bovine gamma-SNAP. NAPG mediates platelet exocytosis and controls the membrane fusion events of this process. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NSF Antibody
NBP1-87035
Immunocytochemistry/ Immunofluorescence NSF Antibody
Immunohistochemistry-Paraffin NSF Antibody
Western Blot NSF Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
VAMP-2 Antibody
NB300-595
Flow Cytometry VAMP-2 Antibody
Western Blot VAMP-2 Antibody
Western Blot VAMP-2 Antibody
(4 Publications)
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
VAMP3/Cellubrevin
Antibody
NB300-510
Western Blot VAMP3/Cellubrevin Antibody
Western Blot VAMP3/Cellubrevin Antibody
Western Blot VAMP3/Cellubrevin Antibody
(11 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
NAPA Antibody
NBP1-32493
Western Blot NAPA Antibody
Immunocytochemistry/ Immunofluorescence NAPA Antibody
Immunocytochemistry/ Immunofluorescence NAPA Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
VTI1B Antibody
NBP2-33414
Western Blot VTI1B Antibody
Immunohistochemistry-Paraffin VTI1B Antibody
Immunocytochemistry/ Immunofluorescence VTI1B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Syntaxin 1A
Antibody (2B2F10)
NBP3-15706
Immunohistochemistry-Paraffin Syntaxin 1A Antibody (2B2F10)
Immunohistochemistry Syntaxin 1A Antibody (2B2F10)
Immunohistochemistry Syntaxin 1A Antibody (2B2F10)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Syntaxin 4 Antibody
NBP1-87374
Immunocytochemistry/ Immunofluorescence Syntaxin 4 Antibody
Western Blot Syntaxin 4 Antibody
Immunohistochemistry-Paraffin Syntaxin 4 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
SNAP23 Antibody
NBP2-20434
Western Blot SNAP23 Antibody
Immunocytochemistry/ Immunofluorescence SNAP23 Antibody
Western Blot SNAP23 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Syntaxin-BP1
Antibody [Unconjugate
AF5675
Western Blot Syntaxin-BP1 Antibody [Unconjugated]
Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]
Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
BDNF [HRP]
DBD00
N/A BDNF [HRP]
N/A BDNF [HRP]
N/A BDNF [HRP]
(104 Publications)
Species: Hu
Applications: ELISA
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
VAMP-1 Antibody
[Unconjugated]
AF4828
Western Blot VAMP-1 Antibody [Unconjugated]
Immunohistochemistry VAMP-1 Antibody [Unconjugated]
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, WB
VAMP-8 Antibody
[Unconjugated]
AF5354
Western Blot VAMP-8 Antibody [Unconjugated]
Immunohistochemistry VAMP-8 Antibody [Unconjugated]
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, WB

Epimorphin/Syntaxin 2 ...
MAB2568
Immunohistochemistry Epimorphin/Syntaxin 2 Antibody (338930) [Unconjugated]
Species: Mu
Applications: IHC, WB
GATE-16/GABARAPL2
Antibody - BSA Free
NBP2-82090
Western Blot GATE-16/GABARAPL2 Antibody - BSA Free
Immunohistochemistry-Paraffin GATE-16/GABARAPL2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GATE-16/GABARAPL2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for NAPG Protein (NBP1-86101PEP) (0)

There are no publications for NAPG Protein (NBP1-86101PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAPG Protein (NBP1-86101PEP) (0)

There are no reviews for NAPG Protein (NBP1-86101PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NAPG Protein (NBP1-86101PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NAPG Products

Research Areas for NAPG Protein (NBP1-86101PEP)

Find related products by research area.

Blogs on NAPG

There are no specific blogs for NAPG, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Glut4 Antibody - BSA Free
NBP1-49533

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NAPG Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NAPG