Myosin 1A Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Myosin 1A. Peptide sequence: ILEDNSFEQFVINYCNEKLQQVFIEMTLKEEQEEYKREGIPWTKVDYFDN The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MYO1A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Myosin 1A Antibody
Background
MYO1A, also known as Unconventional myosin-Ia, is a 1,043 amino acid protein that is 118 kDa, expressed by enterocytes, the epithelial cells that line the luminal surface of the small intestine, functions as actin-based molecular motor that, upon interaction with actin filaments, utilize energy from ATP hydrolysis to generate mechanical force, and potentially it is involved in directing the movement of organelles along actin filaments. Current research is being performed on this proteins involvement in deafness, autosomal dominant 48, spinal cord injury, brachial plexus injuries, sensorineural hearing loss, chronic obstructive pulmonary disease, myotonic dystrophy, pulmonary disease, t cell deficiency, and retinitis. The protein has been linked to the RhoA pathway, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, epithelial adherens junctions, cellular effects of sildenafil, ILK signaling, epithelial tight junctions, RhoGDI pathway, PAK pathway, and Fc-GammaR-mediated phagocytosis in macrophages pathways where it interacts with BAZ1B, FBL, MAP3K3, SMARCA5, USP20, NEK6, PHLDA3, and over 50 other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: All-Multi
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: ICC/IF, WB
Species: Dr, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Publications for Myosin 1A Antibody (NBP2-85349) (0)
There are no publications for Myosin 1A Antibody (NBP2-85349).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myosin 1A Antibody (NBP2-85349) (0)
There are no reviews for Myosin 1A Antibody (NBP2-85349).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Myosin 1A Antibody (NBP2-85349) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myosin 1A Products
Research Areas for Myosin 1A Antibody (NBP2-85349)
Find related products by research area.
|
Blogs on Myosin 1A