Novus Biologicals products are now on bio-techne.com

MyBPC3 Recombinant Protein Antigen

Name: MyBPC3 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-13631PEP
Price: 279 USD

Images

There are currently no images for MyBPC3 Protein (NBP2-13631PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MyBPC3 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYBPC3. Source: E. coli Amino Acid Sequence: QPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	MYBPC3
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13631. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MyBPC3 Recombinant Protein Antigen

Cardiac MyBP-C
CMH4
C-protein, cardiac muscle isoform
DKFZp779E1762
FHC
MYBP-C
MyBPC3
myosin binding protein C, cardiac
myosin-binding protein C, cardiac
myosin-binding protein C, cardiac-type

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MYH7 Antibody
(940906) [Unconjugate

MAB9096

Western Blot MYH7 Antibody (940906) [Unconjugated]

Species: Hu

Applications: IHC, WB

Recombinant Human
PRH2 GST (N-Term) Pro ...

H00005555-P01

Species: Hu

Applications: ELISA, AP, PA, PAGE, WB

Myosin Heavy Chain
Antibody (MF20) [Unco ...

MAB4470

Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]

(1 Review)

(165 Publications)

Species: All-Multi

Applications: ICC, IHC, WB

Cardiac Troponin T
Antibody (200805) [Un ...

MAB1874

Immunohistochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)

(18 Publications)

Species: Hu

Applications: ICC, IHC

Troponin I Type 3
(cardiac) Antibody (2 ...

NBP2-35336

Immunohistochemistry-Paraffin Troponin I Type 3 (cardiac) Antibody (2C9) - BSA Free

Species: Hu, Mu

Applications: IHC, IHC-P, WB

Titin Antibody

NBP1-88071

(4 Publications)

Species: Hu, Rt

Applications: ICC/IF, IHC, IHC-P

Tropomyosin-1
Antibody

NBP1-33716

Immunohistochemistry-Paraffin Tropomyosin-1 Antibody

Species: Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Myosin Light Chain
2 Antibody

NBP1-85541

(1 Review)

(2 Publications)

Species: Hu, Mu

Applications: IHC, IHC-Fr, IHC-P, WB

Actin Alpha 1
Cardiac Muscle Antibo ...

NBP1-97725

Immunocytochemistry/ Immunofluorescence Actin Alpha 1 Cardiac Muscle Antibody (22D3) - BSA Free

(1 Review)

(2 Publications)

Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Ferritin Heavy
Chain Antibody

NBP1-31944

Immunohistochemistry-Paraffin Ferritin Heavy Chain Antibody

(6 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Myosin light chain
3 Antibody

NBP1-88068

Species: Hu

Applications: IHC, IHC-P

Troponin C
(cardiac) Antibody

NBP2-37958

Species: Hu

Applications: IHC, IHC-P

hnRNP C1 + C2
Antibody (CL2593)

NBP2-36776

Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

Fibronectin
Antibody - BSA Free

NBP1-91258

(11 Reviews)

(56 Publications)

Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(811 Publications)

Species: Hu

Applications: BA

Thyroglobulin
Antibody (2H11 + 6E1)

NBP2-34294

Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)

(3 Reviews)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P

Phospholamban
Antibody

NBP2-19807

Immunohistochemistry-Paraffin Phospholamban Antibody

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

MyBPC3 Recombinant
Protein Antigen

NBP2-13631PEP

Species: Hu

Applications: AC

Publications for MyBPC3 Protein (NBP2-13631PEP) (0)

There are no publications for MyBPC3 Protein (NBP2-13631PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MyBPC3 Protein (NBP2-13631PEP) (0)

There are no reviews for MyBPC3 Protein (NBP2-13631PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MyBPC3 Protein (NBP2-13631PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MyBPC3 Products

Blogs on MyBPC3

There are no specific blogs for MyBPC3, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.

Myosin Heavy Chain Antibody (MF20) [Unconjugated]
MAB4470

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our MyBPC3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

MYBPC3

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

MyBPC3 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

MyBPC3 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for MyBPC3 Recombinant Protein Antigen

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for MyBPC3 Protein (NBP2-13631PEP) (0)

Reviews for MyBPC3 Protein (NBP2-13631PEP) (0)

FAQs for MyBPC3 Protein (NBP2-13631PEP) (0)

Additional MyBPC3 Products

Blogs on MyBPC3

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics