Novus Biologicals products are now on bio-techne.com

MUC4 Recombinant Protein Antigen

Images

 
There are currently no images for MUC4 Recombinant Protein Antigen (NBP1-86505PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

MUC4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MUC4.

Source: E. coli

Amino Acid Sequence: IQYTSNAEDANFTLRDSCTDLELFENGTLLWTPKSLEPFTLEILARSAKIGLASALQPRTVVCHCNAESQCLYNQTSRVGNSSLEVAGCKCDGGTFGRYCEGSEDACEEPCFPSVHCVPGKGCEACPPNLTGD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MUC4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86505.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MUC4 Recombinant Protein Antigen

  • Ascites sialoglycoprotein
  • ASGP
  • HSA276359
  • MUC4
  • MUC-4
  • mucin 4, cell surface associated
  • mucin 4, tracheobronchial
  • mucin-4
  • Pancreatic adenocarcinoma mucin
  • Testis mucin
  • Tracheobronchial mucin

Background

MUC4 is a constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, and is a highly glycosylated proteins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. MUC4 antibody studies have shown that MUC4 encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of MUC4 have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. MUC4 is expressed in a wide variety of carcinomas making MUC4 antibodies a key cancer research tool.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60046
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-15196
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, IP, WB
1129-ER
Species: Hu
Applications: BA
NBP2-44434
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
5609-MU
Species: Hu
Applications: Bind
236-EG
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-82607
Species: Hu
Applications: IHC, IHC-P
MAB3481
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
NBP2-24566
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86505PEP
Species: Hu
Applications: AC

Publications for MUC4 Recombinant Protein Antigen (NBP1-86505PEP) (0)

There are no publications for MUC4 Recombinant Protein Antigen (NBP1-86505PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC4 Recombinant Protein Antigen (NBP1-86505PEP) (0)

There are no reviews for MUC4 Recombinant Protein Antigen (NBP1-86505PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MUC4 Recombinant Protein Antigen (NBP1-86505PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MUC4 Products

Research Areas for MUC4 Recombinant Protein Antigen (NBP1-86505PEP)

Find related products by research area.

Blogs on MUC4.

MUC4 (Mucin-4)
Mucus is the viscous secretion that covers epithelial surfaces (trachea, colon, and cervix) and consists of twenty highly glycosylated proteins called mucins. The mucin family all are high-molecular weight proteins with oligosaccharides attached to th...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MUC4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC4