Novus Biologicals products are now on bio-techne.com

Mkl1 Recombinant Protein Antigen

Name: Mkl1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-59047PEP
Price: 279 USD

Images

There are currently no images for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Mkl1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MKL1. Source: E. coli Amino Acid Sequence: EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	MRTFA
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10-100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59047. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mkl1 Recombinant Protein Antigen

AMKL
KIAA1438
MALSAP and coiled-coil domain
megakaryoblastic leukemia (translocation) 1
Megakaryoblastic leukemia 1 protein
Megakaryocytic acute leukemia protein
MKL/myocardin-like protein 1
Myocardin-related transcription factor A
RNA-binding motif protein 15/megakaryoblastic leukemia-1 fusion protein

Background

MKL1 (megakaryoblastic leukemia 1 protein) was identified as part of a t(1;22) translocation with RBM15 associated with acute megakaryoblastic leukemia. It is a transcriptional coactivator of serum response factor (SRF) that promotes muscle differentiation and also plays a role in promoting maturation of megakaryocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Serum Response
Factor SRF Antibody ( ...

NBP3-13785

Immunocytochemistry/ Immunofluorescence Serum Response Factor SRF Antibody (PCRP-SRF-1F7)

Immunohistochemistry-Paraffin Serum Response Factor SRF Antibody (PCRP-SRF-1F7)

Species: Hu

Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB

TLR4 Antibody
(76B357.1) - BSA Free

NB100-56566

Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free

(5 Reviews)

(140 Publications)

Species: Bv, Hu, Ma, Mu, Po, Rt

Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB

MyD88 Inhibitor
Peptide Set

NBP2-29328

(3 Reviews)

(99 Publications)

Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze

Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo

TLR2 Antibody
(TL2.1) - BSA Free

NB100-56722

Flow Cytometry TLR2 Antibody (TL2.1) - BSA Free

Block/ Neutralize TLR2 Antibody (TL2.1) - BSA Free

(64 Publications)

Species: Ca, Hu, Mu, Rb, Rt

Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB

TIRAP (TLR2 and
TLR4) Inhibitor Pepti ...

NBP2-26245

(8 Publications)

Species: Hu, Mu

Applications: Flow, In vitro

TRIF/TICAM1
Antibody - BSA Free

NB120-13810

Immunohistochemistry-Paraffin TRIF/TICAM1 Antibody - BSA Free

(37 Publications)

Species: Mu, Po, Rt

Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

TRAM/TICAM2
Antibody

NBP2-24686

Species: Bv, Hu, Mu, Ma-Op, Pm, Rt

Applications: IHC, IHC-P, WB

MKL2 Antibody

NBP1-46209

(4 Publications)

Species: Hu, Pm, Mu

Applications: IB, ICC/IF, IHC, IHC-P, IP, WB

Myocardin Antibody
(355521) [Unconjugate ...

MAB4028

(15 Publications)

Species: Hu, Mu

Applications: WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(811 Publications)

Species: Hu

Applications: BA

SLURP1 Antibody

AF4479

(1 Publication)

Species: Hu

Applications: IHC

Neurophysin
II/Arg-vasopressin An ...

AF009

Species: Hu

Applications: IHC, WB

RNF36 Antibody

NB100-1207

(1 Publication)

Species: Hu, Mu

Applications: IHC, IHC-P, PEP-ELISA, WB

DNER Antibody
[Unconjugated]

AF2254

Immunocytochemistry/ Immunofluorescence DNER Antibody [Unconjugated]

(12 Publications)

Species: Mu

Applications: IHC, WB

RhoA Antibody

NB100-91273

Immunohistochemistry-Paraffin RhoA Antibody

(1 Review)

(5 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TLR3 Antibody
(40C1285.6) - BSA Fre

NBP2-24875

Western Blot TLR3 Antibody (40C1285.6) - BSA Free

(87 Publications)

Species: Ca, Hu, Mu

Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB

TRAM1 Antibody

NBP1-80669

(2 Publications)

Species: Hu

Applications: IHC, IHC-P

RBM15 Antibody

NBP1-82465

Immunohistochemistry-Paraffin RBM15 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RhoD Antibody

NBP1-58359

Species: Hu

Applications: IHC, IHC-P, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, WB

Publications for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP) (0)

There are no publications for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP) (0)

There are no reviews for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mkl1 Products

Research Areas for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP)

Find related products by research area.

Blogs on Mkl1

There are no specific blogs for Mkl1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.

TLR4 Antibody (76B357.1) - BSA Free
NB100-56566

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Mkl1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

MRTFA

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Mkl1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Mkl1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Mkl1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP) (0)

Reviews for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP) (0)

FAQs for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP) (0)

Additional Mkl1 Products

Research Areas for Mkl1 Recombinant Protein Antigen (NBP2-59047PEP)

Blogs on Mkl1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics