Home » Mineralocorticoid R/NR3C2 » Mineralocorticoid R/NR3C2 Proteins » Mineralocorticoid R/NR3C2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Mineralocorticoid R/NR3C2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Mineralocorticoid R/NR3C2 Recombinant Protein Antigen (NBP2-57853PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Mineralocorticoid R/NR3C2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Mineralocorticoid R/NR3C2.

Source: E. coli

Amino Acid Sequence: PSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NR3C2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57853.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mineralocorticoid R/NR3C2 Recombinant Protein Antigen

  • FLJ41052
  • MGC133092
  • Mineralocorticoid R
  • mineralocorticoid receptor 1
  • mineralocorticoid receptor delta
  • MineralocorticoidR
  • MLR
  • MLRmineralocorticoid receptor
  • MRMCRaldosterone receptor
  • NR3C2
  • NR3C2VIT
  • Nuclear receptor subfamily 3 group C member 2
  • nuclear receptor subfamily 3, group C, member 2

Background

Steroid receptors are ligand dependent, intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Mineralocorticoids are a family of steroids, secreted by the adrenal cortex, necessary for the regulation of a number of metabolic processes including electrolyte regulation. These compounds exert their effect through their interaction with the mineralocorticoid receptor and that complex's subsequent association with DNA. Given the function of mineralocorticoids, it is not surprising to find that the kidney is a primary target organ for mineralocorticoids and that this organ has been shown to contain Mineralocorticoid Receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Glutathione
Reductase Antibody
NBP2-16684
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
B7-1/CD80 Antibody
(37711) [Unconjugated ...
MAB140
Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]
Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]
Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]
(26 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(301 Publications)
Species: Mu
Applications: ELISA
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
B7-2/CD86 Antibody
(BU63)
NBP2-25208
Knockout Validated B7-2/CD86 Antibody (BU63)
Immunocytochemistry/ Immunofluorescence B7-2/CD86 Antibody (BU63)
Flow Cytometry B7-2/CD86 Antibody (BU63)
(27 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(452 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Renin Antibody
(411507) - Propeptide
MAB4447
Immunohistochemistry Renin Antibody (411507) - Propeptide
(6 Publications)
Species: Hu
Applications: IHC, WB

Publications for Mineralocorticoid R/NR3C2 Recombinant Protein Antigen (NBP2-57853PEP) (0)

There are no publications for Mineralocorticoid R/NR3C2 Recombinant Protein Antigen (NBP2-57853PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mineralocorticoid R/NR3C2 Recombinant Protein Antigen (NBP2-57853PEP) (0)

There are no reviews for Mineralocorticoid R/NR3C2 Recombinant Protein Antigen (NBP2-57853PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Mineralocorticoid R/NR3C2 Recombinant Protein Antigen (NBP2-57853PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mineralocorticoid R/NR3C2 Products

Blogs on Mineralocorticoid R/NR3C2

There are no specific blogs for Mineralocorticoid R/NR3C2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Mineralocorticoid R/NR3C2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NR3C2