![Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161] - WB Suggested Anti-METAP2 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human brain](http://images.novusbio.com/fullsize/Methionine-Aminopeptidase-2-METAP2-Antibody-Western-Blot-NBP2-84161-img0002.jpg "Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161] - WB Suggested Anti-METAP2 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human brain")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human Methionine Aminopeptidase 2/METAP2. Peptide sequence: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | METAP2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody-SuperBUGS-Western-Blot-NBP1-42827-img0005.jpg)
![Western Blot MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody---SuperBUGS-Western-Blot-NBP1-42827-img0003.jpg)
![Immunohistochemistry MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody---SuperBUGS-Immunohistochemistry-NBP1-42827-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Methionine Aminopeptidase 2/METAP2 Antibody (NBP2-84161)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | METAP2 |
![Immunohistochemistry-Paraffin: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161] - Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. METAP2 Antibody concentration is 5 ug/ml.](http://images.novusbio.com/fullsize/Methionine-Aminopeptidase-2-METAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-84161-img0001.jpg "Immunohistochemistry-Paraffin: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161] - Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. METAP2 Antibody concentration is 5 ug/ml.")
![Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161] - Host: Rabbit. Target Name: METAP2. Sample Type: Jurkat. Antibody Dilution: 1.0ug/mlMETAP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells](http://images.novusbio.com/fullsize/Methionine-Aminopeptidase-2-METAP2-Antibody-Western-Blot-NBP2-84161-img0003.jpg "Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161] - Host: Rabbit. Target Name: METAP2. Sample Type: Jurkat. Antibody Dilution: 1.0ug/mlMETAP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells")
![Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunocytochemistry_6578.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunohistochemistry_6959.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images/mab1904_human-scgf-clec11a-mab-clone-239029-4120241252123.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images2/Nestin_MAB1259_Immunocytochemistry_6561.jpg)
![Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1259_human-nestin-mab-clone-196908-intracellular-staining-by-flow-cytometry-24120239959.jpg)
![Western Blot Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/mab1259_human-nestin-mab-clone-196908-41202410481129.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")