Home » Mcl-1 » Mcl-1 Antibodies » Mcl-1 Antibody - BSA Free

Mcl-1 Antibody - BSA Free

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Mcl-1 Antibody [NBP1-90006] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: Mcl-1 Antibody [NBP1-90006] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price
BSA Free
NBP1-90006-25ul
Novus Biologicals offers 100% Guarantee

Mcl-1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mcl-1 Recombinant Protein Antigen (NBP1-90006PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mcl-1 Antibody - BSA Free

  • BCL2L3
  • bcl2-L-3
  • BCL2L3MGC104264
  • Bcl-2-like protein 3
  • Bcl-2-related protein EAT/mcl1
  • EAT
  • induced myeloid leukemia cell differentiation protein Mcl-1
  • Mcl1
  • Mcl-1
  • mcl1/EAT
  • MCL1-ES
  • MCL1L
  • MCL1S
  • MGC1839
  • myeloid cell leukemia ES
  • myeloid cell leukemia sequence 1 (BCL2-related)
  • TM

Background

Mcl-1 (Myeloid cell leukemia-1) is Bcl-2-related and was identified as an early-induction gene that increased in expression during the differentiation of human myeloblastic leukemia cell ML-1, or exposure to different DNA damaging agents. The level of Mcl-1 is decreased in peripheral B lymphocytes undergoing apoptosis following treatment with apoptotic stimuli such as TGF-alpha 1 and forskolin. Expression of Mcl-1 is able to delay apoptosis induced by over-expression of c-myc in CHO 5AHSmyc cells. In hematopoietic FDC-P1 cells, Mcl-1 interacts with another Bcl-2-related protein, Bax, and prolongs cell viability after treatment with different apoptotic reagents.This monoclonal antibody detected a 37kd MCL1 in BCBL-1 cell lysate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(28 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Bax Antibody (6A7)
- Azide and BSA Free
NBP1-28566
Western Blot Bax Antibody (6A7) - Azide and BSA Free
Western Blot Bax Antibody (6A7) - Azide and BSA Free
Immunohistochemistry-Frozen Bax Antibody (6A7) - Azide and BSA Free
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
BAK Antibody
[Unconjugated]
AF816
Western Blot BAK Antibody [Unconjugated]
Immunocytochemistry BAK Antibody [Unconjugated]
Immunohistochemistry BAK Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, IHC, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(390 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Bim Antibody - BSA
Free
NBP1-76963
Western Blot Bim Antibody - BSA Free
Western Blot Bim Antibody - BSA Free
Western Blot Bim Antibody - BSA Free
(8 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(51 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Noxa Antibody
(114C307.1) - Non-Rec ...
NB600-1159
Immunocytochemistry/ Immunofluorescence Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal
Flow Cytometry Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal
Flow Cytometry Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal
(2 Reviews)
(77 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
XIAP Antibody
[Unconjugated]
AF8221
Western Blot XIAP Antibody [Unconjugated]
Simple Western XIAP Antibody [Unconjugated]
Knockout Validated XIAP Antibody [Unconjugated]
(25 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
Western Blot STAT3 Antibody (232209) [Unconjugated]
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
BID Antibody
[Unconjugated]
AF860
Simple Western BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
(1 Review)
(40 Publications)
Species: Hu, Mu
Applications: IP, Simple Western, WB
TRAIL/TNFSF10
[Unconjugated]
375-TL
TRAIL/TNFSF10 [Unconjugated]
(1 Review)
(54 Publications)
Species: Hu
Applications: BA
PARP Antibody
(194C1439) - Cleaved ...
NB100-56599
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - BSA Free
(10 Publications)
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
Mcl-1 Antibody -
BSA Free
NBP1-90006
Mcl-1 Antibody - BSA Free
Species: Hu
Applications: IHC

Publications for Mcl-1 Antibody (NBP1-90006) (0)

There are no publications for Mcl-1 Antibody (NBP1-90006).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mcl-1 Antibody (NBP1-90006) (0)

There are no reviews for Mcl-1 Antibody (NBP1-90006). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Mcl-1 Antibody (NBP1-90006) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mcl-1 Products

Research Areas for Mcl-1 Antibody (NBP1-90006)

Find related products by research area.

Blogs on Mcl-1.

Check out the latest blog posts on Mcl-1.

  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mcl-1 Antibody - BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol MCL1