Mcl-1 Antibody (CL1128) [Janelia Fluor® 669] Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG |
Isotype |
IgG1 |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
MCL1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Protein A purified |
Notes
Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.
Alternate Names for Mcl-1 Antibody (CL1128) [Janelia Fluor® 669]
Background
Mcl-1 (Myeloid cell leukemia-1) is Bcl-2-related and was identified as an early-induction gene that increased in expression during the differentiation of human myeloblastic leukemia cell ML-1, or exposure to different DNA damaging agents. The level of Mcl-1 is decreased in peripheral B lymphocytes undergoing apoptosis following treatment with apoptotic stimuli such as TGF-alpha 1 and forskolin. Expression of Mcl-1 is able to delay apoptosis induced by over-expression of c-myc in CHO 5AHSmyc cells. In hematopoietic FDC-P1 cells, Mcl-1 interacts with another Bcl-2-related protein, Bax, and prolongs cell viability after treatment with different apoptotic reagents.This monoclonal antibody detected a 37kd MCL1 in BCBL-1 cell lysate.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for Mcl-1 Antibody (NBP2-52968JF669) (0)
There are no publications for Mcl-1 Antibody (NBP2-52968JF669).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mcl-1 Antibody (NBP2-52968JF669) (0)
There are no reviews for Mcl-1 Antibody (NBP2-52968JF669).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Mcl-1 Antibody (NBP2-52968JF669) (0)