![Immunohistochemistry-Paraffin: MAGI1 Antibody [NBP1-89182] - Staining in human fallopian tube and tonsil tissues using anti-MAGI1 antibody. Corresponding MAGI1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MAGI1-Antibody-Immunohistochemistry-Paraffin-NBP1-89182-img0006.jpg "Immunohistochemistry-Paraffin: MAGI1 Antibody [NBP1-89182] - Staining in human fallopian tube and tonsil tissues using anti-MAGI1 antibody. Corresponding MAGI1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHAENEEEDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPITDPSQKFPQY |
| Predicted Species | Mouse (93%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAGI1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MAGI1 Antibody (NBP1-89182)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAGI1 |
![Immunohistochemistry-Paraffin: MAGI1 Antibody [NBP1-89182] - Staining of human tonsil shows low expression as expected.](http://images.novusbio.com/fullsize/MAGI1-Antibody-Immunohistochemistry-Paraffin-NBP1-89182-img0005.jpg "Immunohistochemistry-Paraffin: MAGI1 Antibody [NBP1-89182] - Staining of human tonsil shows low expression as expected.")
![Immunohistochemistry-Paraffin: MAGI1 Antibody [NBP1-89182] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/MAGI1-Antibody-Immunohistochemistry-Paraffin-NBP1-89182-img0004.jpg "Immunohistochemistry-Paraffin: MAGI1 Antibody [NBP1-89182] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_6775.jpg)
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_10004.jpg)
![Immunocytochemistry/ Immunofluorescence Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images/af3159_mouse-nephrin-affinity-purified-polyclonal-ab-41202410484365.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")