Novus Biologicals products are now on bio-techne.com

Latrophilin 1/LPHN1 Recombinant Protein Antigen

Images

 
There are currently no images for Latrophilin 1/LPHN1 Protein (NBP1-85609PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Latrophilin 1/LPHN1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LPHN1.

Source: E. coli

Amino Acid Sequence: GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADGRL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85609.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Latrophilin 1/LPHN1 Recombinant Protein Antigen

  • Calcium-independent alpha-latrotoxin receptor 1
  • CIRL1
  • CIRL-1
  • KIAA0821
  • Latrophilin 1
  • latrophilin-1
  • LEC2
  • LEC2CL1
  • Lectomedin-2
  • LPHN1

Background

Latrophilin-1 is a brain-specific Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner. As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splicing sites. CIRL is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions. Latrophilin-1 has been reported to be expressed predominantly in the brain. Very weak expression has also been documented in human heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from brain, eye, kidney, lung, and lymph node libraries. In addition, ESTs have been isolated from the following cancer libraries: brain, choriocarcinoma, epithelioid carcinoma, kidney, and lung.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77128
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
AF5825
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-30583
Species: Hu
Applications: IHC, IHC-P
MAB5916
Species: Hu, Mu, Rt
Applications: Simple Western, WB
DKK300
Species: Hu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
NBL1-16115
Species: Hu
Applications: WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DRN00B
Species: Hu
Applications: ELISA
NBP2-12913
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
M6000B
Species: Mu
Applications: ELISA
350-NS
Species: Fe, Hu, RM
Applications: BA, BA

Publications for Latrophilin 1/LPHN1 Protein (NBP1-85609PEP) (0)

There are no publications for Latrophilin 1/LPHN1 Protein (NBP1-85609PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Latrophilin 1/LPHN1 Protein (NBP1-85609PEP) (0)

There are no reviews for Latrophilin 1/LPHN1 Protein (NBP1-85609PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Latrophilin 1/LPHN1 Protein (NBP1-85609PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Latrophilin 1/LPHN1 Products

Research Areas for Latrophilin 1/LPHN1 Protein (NBP1-85609PEP)

Find related products by research area.

Blogs on Latrophilin 1/LPHN1

There are no specific blogs for Latrophilin 1/LPHN1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Latrophilin 1/LPHN1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADGRL1