Novus Biologicals products are now on bio-techne.com

Kir2.2 Recombinant Protein Antigen

Images

 
There are currently no images for Kir2.2 Protein (NBP1-89696PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Kir2.2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNJ12.

Source: E. coli

Amino Acid Sequence: RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNJ12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89696.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kir2.2 Recombinant Protein Antigen

  • ATP-sensitive inward rectifier potassium channel 12
  • hIRK
  • hIRK1
  • hkir2.2x
  • Inward rectifier K(+) channel Kir2.2
  • Inward rectifier K(+) channel Kir2.2v
  • inward rectifier K(+) channel Kir2.6
  • IRK2
  • IRK-2
  • IRK2IRK-2
  • KCNJ12
  • kcnj12x
  • KCNJN1
  • KCNJN1FLJ14167
  • Kir2.2
  • Kir2.2v
  • Potassium channel, inwardly rectifying subfamily J member 12
  • potassium inwardly-rectifying channel, subfamily J, inhibitor 1
  • potassium inwardly-rectifying channel, subfamily J, member 12

Background

FUNCTION: Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. Tissue specificity: Highest level in cerebellum. Moderately found in kidney, forebrain and skeletal muscle. Not detected in uterus, liver and pancreas. Subcellular location: Membrane, Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP3-03005
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33694
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, Single-Cell Western, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP2-57775
Species: Hu
Applications: ICC/IF, WB
NBP2-01702
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88081
Species: Hu
Applications: IHC, IHC-P, WB

Publications for Kir2.2 Protein (NBP1-89696PEP) (0)

There are no publications for Kir2.2 Protein (NBP1-89696PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir2.2 Protein (NBP1-89696PEP) (0)

There are no reviews for Kir2.2 Protein (NBP1-89696PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kir2.2 Protein (NBP1-89696PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kir2.2 Products

Research Areas for Kir2.2 Protein (NBP1-89696PEP)

Find related products by research area.

Blogs on Kir2.2

There are no specific blogs for Kir2.2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kir2.2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ12