Home » Kir2.2 » Kir2.2 Proteins » Kir2.2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Kir2.2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Kir2.2 Protein (NBP1-89696PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Kir2.2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNJ12.

Source: E. coli

Amino Acid Sequence: RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNJ12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89696.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kir2.2 Recombinant Protein Antigen

  • ATP-sensitive inward rectifier potassium channel 12
  • hIRK
  • hIRK1
  • hkir2.2x
  • Inward rectifier K(+) channel Kir2.2
  • Inward rectifier K(+) channel Kir2.2v
  • inward rectifier K(+) channel Kir2.6
  • IRK2
  • IRK-2
  • IRK2IRK-2
  • KCNJ12
  • kcnj12x
  • KCNJN1
  • KCNJN1FLJ14167
  • Kir2.2
  • Kir2.2v
  • Potassium channel, inwardly rectifying subfamily J member 12
  • potassium inwardly-rectifying channel, subfamily J, inhibitor 1
  • potassium inwardly-rectifying channel, subfamily J, member 12

Background

FUNCTION: Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. Tissue specificity: Highest level in cerebellum. Moderately found in kidney, forebrain and skeletal muscle. Not detected in uterus, liver and pancreas. Subcellular location: Membrane, Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kir2.1 Antibody
(S112)
NBP2-12900
Immunohistochemistry Kir2.1 Antibody (S112)
Western Blot Kir2.1 Antibody (S112)
Immunohistochemistry Kir2.1 Antibody (S112)
(1 Review)
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
KIR2.3 Antibody -
BSA Free
NBP3-03005
Western Blot KIR2.3 Antibody - BSA Free
Immunohistochemistry-Paraffin KIR2.3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
KIR3DL1 Antibody
(DX9) [Unconjugated]
MAB1225
KIR3DL1 Antibody (DX9) [Unconjugated]
(5 Publications)
Species: Hu
Applications: Block, CyTOF-reported, Flow
GEM Antibody
NBP1-58906
Immunohistochemistry-Paraffin GEM Antibody
Immunohistochemistry GEM Antibody
Western Blot GEM Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
KCNJ1 Antibody
NBP1-82874
Immunohistochemistry-Paraffin KCNJ1 Antibody
Immunohistochemistry-Paraffin KCNJ1 Antibody
Immunohistochemistry-Paraffin KCNJ1 Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
KCNN4 Antibody
NBP2-33694
Immunohistochemistry-Paraffin KCNN4 Antibody
Immunohistochemistry-Paraffin KCNN4 Antibody
Immunohistochemistry-Paraffin KCNN4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Cytokeratin, pan
Antibody (AE-1/AE-3)
NBP2-29429
Dual RNAscope ISH-IHC Cytokeratin, pan Antibody (AE-1/AE-3)
CyTOF-reported Cytokeratin, pan Antibody (AE-1/AE-3)
Flow Cytometry Cytokeratin, pan Antibody (AE-1/AE-3)
(1 Review)
(67 Publications)
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, Single-Cell Western, WB
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western Blot Ikaros/IKZF1 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Ikaros/IKZF1 Antibody [Unconjugated]
Simple Western Ikaros/IKZF1 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
KCNJ14 Antibody
NBP2-57775
Western Blot KCNJ14 Antibody
Immunocytochemistry/ Immunofluorescence KCNJ14 Antibody
Species: Hu
Applications: ICC/IF, WB
Kir3.1 Antibody
(OTI1G3)
NBP2-01702
Flow Cytometry Kir3.1 Antibody (OTI1G3)
Flow Cytometry Kir3.1 Antibody (OTI1G3)
Western Blot Kir3.1 Antibody (OTI1G3)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DLG1 Antibody
NB600-1229
Immunocytochemistry/ Immunofluorescence DLG1 Antibody
Immunocytochemistry/ Immunofluorescence DLG1 Antibody
Western Blot DLG1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Kv4.3 Antibody -
Azide and BSA Free
NBP3-03750
Immunohistochemistry-Paraffin Kv4.3 Antibody - Azide and BSA Free
Western Blot Kv4.3 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
KCNJ10 Antibody
NBP1-20149
Immunohistochemistry-Paraffin KCNJ10 Antibody
Immunohistochemistry-Paraffin KCNJ10 Antibody
Immunohistochemistry-Paraffin KCNJ10 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Kir6.2 Antibody
NBP2-76944
Western Blot Kir6.2 Antibody
Immunocytochemistry/ Immunofluorescence Kir6.2 Antibody
Immunohistochemistry Kir6.2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Kir3.4 Antibody
NBP1-88081
Western Blot Kir3.4 Antibody
Immunohistochemistry Kir3.4 Antibody
Immunohistochemistry-Paraffin Kir3.4 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB

Publications for Kir2.2 Protein (NBP1-89696PEP) (0)

There are no publications for Kir2.2 Protein (NBP1-89696PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir2.2 Protein (NBP1-89696PEP) (0)

There are no reviews for Kir2.2 Protein (NBP1-89696PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kir2.2 Protein (NBP1-89696PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kir2.2 Products

Research Areas for Kir2.2 Protein (NBP1-89696PEP)

Find related products by research area.

Blogs on Kir2.2

There are no specific blogs for Kir2.2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

FFPE tissue sections of human metastatic tonsil were probed for Pan Cytokeratin mRNA (ACD RNAScope probe, catalog # 310221; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processes for IHC using mouse monoclonal antibody (Novus catalog # NBP2-29429) at 0.3 ug/mL for 1 hour at room temperature followed by incubation with the anti-mouse IgG VisUCyte HRP Polymer Antibody (Novus Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).
Cytokeratin, pan Antibody (AE-1/AE-3)
NBP2-29429

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kir2.2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KCNJ12