Home » ITCH/AIP4 » ITCH/AIP4 Proteins » ITCH/AIP4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ITCH/AIP4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ITCH/AIP4 Protein (NBP1-89180PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ITCH/AIP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITCH.

Source: E. coli

Amino Acid Sequence: LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITCH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89180.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ITCH/AIP4 Recombinant Protein Antigen

  • AIF4
  • AIP4
  • AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4))
  • atrophin-1 interacting protein 4
  • Atrophin-1-interacting protein 4
  • dJ468O1.1
  • EC 6.3.2
  • EC 6.3.2.-
  • ITCH
  • itchy (mouse homolog) E3 ubiquitin protein ligase
  • itchy E3 ubiquitin protein ligase homolog (mouse)
  • itchy homolog E3 ubiquitin protein ligase
  • NAPP1
  • NAPP1E3 ubiquitin-protein ligase Itchy homolog
  • NFE2-associated polypeptide 1
  • ubiquitin protein ligase ITCH

Background

Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is a closely related member of the NEDD4-like protein family. This family of proteins are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. This encoded protein contains four tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. It can act as a transcriptional corepressor of p45/NFE2 and may participate in the regulation of immune responses by modifying Notch-mediated signaling. It is highly similar to the mouse Itch protein, which has been implicated in the regulation and differentiation of erythroid and lymphoid cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot ALDH9A1 Antibody
Western Blot ALDH9A1 Antibody
Immunohistochemistry-Paraffin ALDH9A1 Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/ Immunofluorescence Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot ILT6/CD85e/LILRA3 Antibody (2E9)
(6 Publications)
Species: Hu
Applications: ELISA, WB
Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(148 Publications)
Species: Mu
Applications: ELISA
NEDD4 Antibody
(683211) [Unconjugate
MAB6218
Western Blot NEDD4 Antibody (683211) [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Vanilloid R1/TRPV1
Antibody - BSA Free
NBP1-71774
Immunohistochemistry-Paraffin Vanilloid R1/TRPV1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Vanilloid R1/TRPV1 Antibody - BSA Free
Immunohistochemistry Vanilloid R1/TRPV1 Antibody - BSA Free
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
WWP1 Antibody (1A7)
H00011059-M01
Western Blot WWP1 Antibody (1A7)
Western Blot WWP1 Antibody (1A7)
Immunocytochemistry/ Immunofluorescence WWP1 Antibody (1A7)
(20 Publications)
Species: Hu, Pm
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Histamine H4R
Antibody - BSA Free
NLS3775
Immunohistochemistry-Paraffin Histamine H4R Antibody - BSA Free
Immunohistochemistry-Paraffin Histamine H4R Antibody - BSA Free
Immunohistochemistry-Paraffin Histamine H4R Antibody - BSA Free
(2 Publications)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
ITCH/AIP4
Recombinant Protein A
NBP1-89180PEP
ITCH/AIP4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ITCH/AIP4 Protein (NBP1-89180PEP) (0)

There are no publications for ITCH/AIP4 Protein (NBP1-89180PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITCH/AIP4 Protein (NBP1-89180PEP) (0)

There are no reviews for ITCH/AIP4 Protein (NBP1-89180PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ITCH/AIP4 Protein (NBP1-89180PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ITCH/AIP4 Products

Research Areas for ITCH/AIP4 Protein (NBP1-89180PEP)

Find related products by research area.

Blogs on ITCH/AIP4

There are no specific blogs for ITCH/AIP4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ITCH/AIP4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ITCH