![Western Blot: GSTO2 Antibody [NBP2-14075] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/GSTO2-Antibody-Western-Blot-NBP2-14075-img0003.jpg "Western Blot: GSTO2 Antibody [NBP2-14075] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: DVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSTO2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSTO2 |
![Immunocytochemistry/Immunofluorescence: GSTO2 Antibody [NBP2-14075] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.](http://images.novusbio.com/fullsize/GSTO2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14075-img0004.jpg "Immunocytochemistry/Immunofluorescence: GSTO2 Antibody [NBP2-14075] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.")
![Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/GSTO2-Antibody-Immunohistochemistry-Paraffin-NBP2-14075-img0008.jpg "Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human prostate shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/GSTO2-Antibody-Immunohistochemistry-Paraffin-NBP2-14075-img0005.jpg "Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human prostate shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/GSTO2-Antibody-Immunohistochemistry-Paraffin-NBP2-14075-img0006.jpg "Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/GSTO2-Antibody-Immunohistochemistry-Paraffin-NBP2-14075-img0007.jpg "Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/GSTO2-Antibody-Immunohistochemistry-Paraffin-NBP2-14075-img0009.jpg "Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![N/A IL-6R alpha [HRP]](https://images.novusbio.com/images2/DATA_IL6_R_alpha_DR600_ELISA_801.jpg)
![N/A IL-6R alpha [HRP]](https://images.novusbio.com/images2/IL-6_R_alpha_DR600_ELISA_168.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")