![Western Blot: GSTO1 Antibody [NBP1-83321] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/GSTO1-Antibody-Western-Blot-NBP1-83321-img0004.jpg "Western Blot: GSTO1 Antibody [NBP1-83321] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSIS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSTO1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry IL-17D Antibody (246018) [Unconjugated]](https://images.novusbio.com/images2/IL-17D_MAB15041_Immunohistochemistry_6949.jpg)
![Intracellular Staining by Flow Cytometry IL-17D Antibody (246018) [Unconjugated]](https://images.novusbio.com/images2/IL-17D_MAB15041_Flow_Cytometry_8338.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSTO1 |
![Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Analysis in human liver and pancreas tissues using NBP1-83321 antibody. Corresponding GSTO1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GSTO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83321-img0013.jpg "Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Analysis in human liver and pancreas tissues using NBP1-83321 antibody. Corresponding GSTO1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize/GSTO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83321-img0005.jpg "Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/GSTO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83321-img0006.jpg "Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human testis.](http://images.novusbio.com/fullsize/GSTO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83321-img0009.jpg "Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human testis.")
![Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human thyroid gland.](http://images.novusbio.com/fullsize/GSTO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83321-img0010.jpg "Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human thyroid gland.")
![Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human kidney.](http://images.novusbio.com/fullsize/GSTO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83321-img0011.jpg "Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Staining of human kidney.")
![IL-27 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-27 [Unconjugated]")
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")