GBX2 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEET |
Predicted Species |
Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GBX2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 0.04-0.4 ug/ml
|
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for GBX2 Antibody
Background
GBX2 (Gastrulation brain homeobox 2) is a homeobox protein which is involved in enbryonic cell pluripotency and differentiation. GBX2 is expressed in all three embryonic germ layers of the late gastrula/early neurula. Gbx2 is overexpressed in a panel of human prostatic cancer cell lines (TSU-pr1, PC3, DU145, LNCaP).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for GBX2 Antibody (NBP2-56315) (0)
There are no publications for GBX2 Antibody (NBP2-56315).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GBX2 Antibody (NBP2-56315) (0)
There are no reviews for GBX2 Antibody (NBP2-56315).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GBX2 Antibody (NBP2-56315) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GBX2 Products
Research Areas for GBX2 Antibody (NBP2-56315)
Find related products by research area.
|
Blogs on GBX2