Frizzled-10 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 135-230 of human Frizzled-10 (NP_009128.1). RKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVW |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FZD10 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:200-1:2000
|
Theoretical MW |
65 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for Frizzled-10 Antibody - Azide and BSA Free
Background
Frizzled-10 (FZD10) is a Frizzled Receptor that mediates Wnt signaling. It is expressed during development in embryonic limbs, neural tube, and central nervous system. FZD10 has been reported to be expressed in brain, embryo, kidney, liver, lung, pancreas, placenta, skeletal muscle, spinal cord, and testis. ESTs have been isolated from brain, ear, heart/melanocyte/uterus, and kidney libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: IHC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Frizzled-10 Antibody (NBP3-03466) (0)
There are no publications for Frizzled-10 Antibody (NBP3-03466).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Frizzled-10 Antibody (NBP3-03466) (0)
There are no reviews for Frizzled-10 Antibody (NBP3-03466).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Frizzled-10 Antibody (NBP3-03466) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Frizzled-10 Products
Research Areas for Frizzled-10 Antibody (NBP3-03466)
Find related products by research area.
|
Blogs on Frizzled-10