Enteropeptidase/Enterokinase Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QKEGNYGDNWNYGQVTLNETVKFKVAFNAFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSSTNFPNSYPN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TMPRSS15 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Enteropeptidase/Enterokinase Antibody
Background
Enterokinase, also known as Serine protease 7 and Enteropeptidase, is a 113kDa 1019 amino acid protein and can be found in the membrane. The primary function of Enterokinase is to encode an enzyme wich converts the pancreatic proenzyme trypsinogen to trypsin. Current research is being conducted on Enterokinase in relation to breast cancer, fibrosacroma, influenza, steatorrhea, hymenolepiasis and pancreatitis. Enterokinase interacts with SPINK1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: IHC, IP, WB
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Rt
Applications: BA, BA
Species: Hu
Applications: ICC/IF
Publications for Enteropeptidase/Enterokinase Antibody (NBP3-21256) (0)
There are no publications for Enteropeptidase/Enterokinase Antibody (NBP3-21256).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Enteropeptidase/Enterokinase Antibody (NBP3-21256) (0)
There are no reviews for Enteropeptidase/Enterokinase Antibody (NBP3-21256).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Enteropeptidase/Enterokinase Antibody (NBP3-21256) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Enteropeptidase/Enterokinase Products
Research Areas for Enteropeptidase/Enterokinase Antibody (NBP3-21256)
Find related products by research area.
|
Blogs on Enteropeptidase/Enterokinase