![Western Blot: ELOVL5 Antibody [NBP2-33500] - Analysis in human cell lines U-251MG and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/ELOVL5-Antibody-Western-Blot-NBP2-33500-img0011.jpg "Western Blot: ELOVL5 Antibody [NBP2-33500] - Analysis in human cell lines U-251MG and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ELOVL5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP2-33500 | Applications | Species |
|---|---|---|
| Ilaria Balbo, Francesca Montarolo, Enrica Boda, Filippo Tempia, Eriola Hoxha Elovl5 Expression in the Central Nervous System of the Adult Mouse Frontiers in Neuroanatomy 2021-04-29 [PMID: 33994961] |
Secondary Antibodies |
Isotype Controls |
Research Areas for ELOVL5 Antibody (NBP2-33500)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ELOVL5 Antibody [NBP2-33500] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ELOVL5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33500-img0005.jpg "Immunocytochemistry/Immunofluorescence: ELOVL5 Antibody [NBP2-33500] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ELOVL5-Antibody-Immunohistochemistry-Paraffin-NBP2-33500-img0015.jpg "Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining in human breast and pancreas tissues using anti-ELOVL5 antibody. Corresponding ELOVL5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ELOVL5-Antibody-Immunohistochemistry-Paraffin-NBP2-33500-img0009.jpg "Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining in human breast and pancreas tissues using anti-ELOVL5 antibody. Corresponding ELOVL5 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Analysis in human breast and skeletal muscle tissues. Corresponding ELOVL5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ELOVL5-Antibody-Immunohistochemistry-Paraffin-NBP2-33500-img0012.jpg "Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Analysis in human breast and skeletal muscle tissues. Corresponding ELOVL5 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ELOVL5-Antibody-Immunohistochemistry-Paraffin-NBP2-33500-img0013.jpg "Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ELOVL5-Antibody-Immunohistochemistry-Paraffin-NBP2-33500-img0014.jpg "Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.")
![Western Blot SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD-1_AF7550_Western_Blot_12344.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD1_AF7550_Knockout_Validated_24050.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af7550_human-scd-1-affinity-purified-polyclonal-ab-20820241518560.png)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/DATA_TIMP1_DTM100_ELISA_847.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/TIMP-1_DTM100_ELISA_194.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")