Home » EIF2 beta » EIF2 beta Proteins » EIF2 beta Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

EIF2 beta Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for EIF2 beta Protein (NBP2-38483PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

EIF2 beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF2S2.

Source: E. coli

Amino Acid Sequence: DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF2S2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38483.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EIF2 beta Recombinant Protein Antigen

  • DKFZp686L18198
  • EIF2
  • EIF2B
  • EIF2beta
  • eIF-2-beta
  • eukaryotic initiation factor 2-beta
  • eukaryotic translation initiation factor 2 beta
  • eukaryotic translation initiation factor 2 subunit 2
  • Eukaryotic translation initiation factor 2 subunit beta
  • eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD )
  • eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
  • MGC8508

Background

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

eIF2B epsilon
Antibody (5M2D4)
NBP3-16674
Western Blot eIF2B epsilon Antibody (5M2D4)
Immunocytochemistry/ Immunofluorescence eIF2B epsilon Antibody (5M2D4)
Immunohistochemistry-Paraffin eIF2B epsilon Antibody (5M2D4)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
4EBP1 Antibody
NB200-157
Knockout Validated 4EBP1 Antibody
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
eIF4G1 Antibody
NB100-268
Western Blot eIF4G1 Antibody
Immunoprecipitation eIF4G1 Antibody
(26 Publications)
Species: Hu, Po
Applications: IP, WB
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin Ribosomal Protein S6/RPS6 Antibody
Western Blot Ribosomal Protein S6/RPS6 Antibody
Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
SOS2 Antibody
[Unconjugated]
AF6260
Western Blot SOS2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
RASGRF1 Antibody
NBP3-13291
Western Blot RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Species: Mu, Rt
Applications: WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
EIF5 Antibody
NBP2-16311
Western Blot EIF5 Antibody
Immunohistochemistry-Paraffin EIF5 Antibody
Western Blot EIF5 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
eIF4A2 Antibody
NBP2-24529
Western Blot eIF4A2 Antibody
Immunohistochemistry-Paraffin eIF4A2 Antibody
Simple Western eIF4A2 Antibody
(1 Review)
(1 Publication)
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
GEF-H1 Antibody
NBP2-21577
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot SLC2A4RG Antibody (4C10)
Immunocytochemistry/ Immunofluorescence SLC2A4RG Antibody (4C10)
Species: Hu
Applications: ELISA, ICC/IF, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ACOT12 Antibody
(OTI1A11)
NBP2-03605
Flow Cytometry ACOT12 Antibody (OTI1A11)
Flow Cytometry ACOT12 Antibody (OTI1A11)
Western Blot ACOT12 Antibody (OTI1A11)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(223 Publications)
Species: Hu
Applications: BA

Publications for EIF2 beta Protein (NBP2-38483PEP) (0)

There are no publications for EIF2 beta Protein (NBP2-38483PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2 beta Protein (NBP2-38483PEP) (0)

There are no reviews for EIF2 beta Protein (NBP2-38483PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EIF2 beta Protein (NBP2-38483PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EIF2 beta Products

Research Areas for EIF2 beta Protein (NBP2-38483PEP)

Find related products by research area.

Blogs on EIF2 beta

There are no specific blogs for EIF2 beta, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EIF2 beta Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EIF2S2