Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH |
Epitope | LSSAEKRKAK |
Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
Isotype | IgG2a |
Clonality | Monoclonal |
Host | Mouse |
Gene | DICER1 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Protein A purified |
Publication using NBP2-30699 | Applications | Species |
---|---|---|
Zeng J, Dong S, Luo Z et al. The Zika Virus Capsid Disrupts Corticogenesis by Suppressing Dicer Activity and miRNA Biogenesis Cell Stem Cell 2020-08-04 [PMID: 32763144] (WB, Virus) Details: ZIKV |
WB | Virus |
Secondary Antibodies |
Isotype Controls |
Research Areas for Dicer Antibody (NBP2-30699)Find related products by research area.
|
Slicing and Dicing RNA with Dicer Dicer is an RNaseIII-like enzyme capable of cleaving double-stranded RNA (dsRNA) into smaller 21-23 nt RNA fragments known as short interfering RNA (siRNAs). It targets the selective degradation of complementary RNAs in a posttranscriptional gene sile... Read full blog post. |
Ago2 antibodies and dicer-independent biogenesis of miRNA Ago2, also called eIF2C2, antibody is one of 37 reagents targeted to the Argonaute protein family that we at Novus Biologicals have in our antibody catalogue. Argonaute proteins are encoded by genes which play an important role in regulating the contr... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.