Home » DDX41 » DDX41 Proteins » DDX41 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DDX41 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DDX41 Recombinant Protein Antigen (NBP2-48918PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DDX41 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX41.

Source: E. coli

Amino Acid Sequence: KTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX41
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48918.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DDX41 Recombinant Protein Antigen

  • ABSDEAD-box protein abstrakt
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
  • DEAD box protein 41
  • DEAD box protein abstrakt homolog
  • EC 3.6.1
  • EC 3.6.4.13,2900024F02Rik
  • MGC8828
  • probable ATP-dependent RNA helicase DDX41
  • putative RNA helicase

Background

DDX41, also known as Probable ATP-dependent RNA helicase DDX41, is a 69.8 kDa, 622 amino acid protein that is involved in gene expression after transcription as a member of the DEAD box protein family. Current research is being conducted for diseases and disorders such as immunodeficiency, nephritis, tetanus, embryonal carcinoma, hepatitis, spinal muscular atrophy, lyme disease, and neuroblastoma. The protein is a part of the RNA processing pathway, where it interacts with NKAP, CDC5L, CCNB1, USP36, and SNW1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Regucalcin Antibody
NBP1-80849
Western Blot Regucalcin Antibody
Immunohistochemistry-Paraffin Regucalcin Antibody
Immunohistochemistry-Paraffin Regucalcin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
RIG-I Antibody
AF4859
Western Blot RIG-I Antibody
(2 Publications)
Species: Hu
Applications: WB
POR/Cytochrome
P450 Reductase Antibo ...
NBP1-47914
Flow Cytometry POR/Cytochrome P450 Reductase Antibody (OTI3F10)
Immunocytochemistry/ Immunofluorescence POR/Cytochrome P450 Reductase Antibody (OTI3F10)
Immunocytochemistry/ Immunofluorescence POR/Cytochrome P450 Reductase Antibody (OTI3F10)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
GATA-3 Antibody
[Unconjugated]
AF2605
Western Blot GATA-3 Antibody [Unconjugated]
Immunocytochemistry GATA-3 Antibody [Unconjugated]
Simple Western GATA-3 Antibody [Unconjugated]
(43 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Western Blot PAR1/Thrombin Receptor Antibody (N2-11)
Immunocytochemistry/ Immunofluorescence PAR1/Thrombin Receptor Antibody (N2-11)
Immunohistochemistry PAR1/Thrombin Receptor Antibody (N2-11)
(10 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
GLUT10 Antibody
NBP3-12262
Immunohistochemistry-Paraffin GLUT10 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
VASA Antibody
[Unconjugated]
AF2030
Western Blot VASA Antibody [Unconjugated]
Immunohistochemistry VASA Antibody [Unconjugated]
Immunohistochemistry VASA Antibody [Unconjugated]
(57 Publications)
Species: Hu
Applications: IHC, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
DDX5 Antibody
NB200-351
Immunoprecipitation DDX5 Antibody
Immunohistochemistry DDX5 Antibody
Immunohistochemistry DDX5 Antibody
(1 Review)
(5 Publications)
Species: Ha, Hu, Mu
Applications: IHC, IHC-P, IP, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB

TMEFF2/Tomoregulin-2 A
NBP2-01863
Western Blot TMEFF2/Tomoregulin-2 Antibody (OTI1F9)
Immunohistochemistry-Paraffin TMEFF2/Tomoregulin-2 Antibody (OTI1F9)
Immunohistochemistry-Paraffin TMEFF2/Tomoregulin-2 Antibody (OTI1F9)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TfR (Transferrin
R) Antibody - BSA Fre
NB100-92243
Immunohistochemistry-Paraffin TfR (Transferrin R) Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TfR (Transferrin R) Antibody - BSA Free
Western Blot TfR (Transferrin R) Antibody - BSA Free
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
PORCN Antibody
NBP1-59677
Western Blot PORCN Antibody
Western Blot PORCN Antibody
Immunohistochemistry PORCN Antibody
(5 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TXNRD2 Antibody -
BSA Free
NBP2-94256
Immunohistochemistry-Paraffin TXNRD2 Antibody - BSA Free
Western Blot TXNRD2 Antibody - BSA Free
Immunohistochemistry-Paraffin TXNRD2 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
VDAC2 Antibody
NBP2-20849
Immunohistochemistry-Paraffin VDAC2 Antibody
Immunohistochemistry-Paraffin VDAC2 Antibody
Immunoprecipitation VDAC2 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Thioredoxin
Reductase 1/TRXR1 Ant ...
MAB7428
Western Blot Thioredoxin Reductase 1/TRXR1 Antibody (489804)
Intracellular Staining by Flow Cytometry Thioredoxin Reductase 1/TRXR1 Antibody (489804)
(5 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
eIF4A1 Antibody
NBP2-24632
Western Blot eIF4A1 Antibody
Immunohistochemistry-Paraffin eIF4A1 Antibody
Western Blot eIF4A1 Antibody
(2 Publications)
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
DDX41 Recombinant
Protein Antigen
NBP2-48918PEP
DDX41 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for DDX41 Recombinant Protein Antigen (NBP2-48918PEP) (0)

There are no publications for DDX41 Recombinant Protein Antigen (NBP2-48918PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX41 Recombinant Protein Antigen (NBP2-48918PEP) (0)

There are no reviews for DDX41 Recombinant Protein Antigen (NBP2-48918PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DDX41 Recombinant Protein Antigen (NBP2-48918PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX41 Products

Research Areas for DDX41 Recombinant Protein Antigen (NBP2-48918PEP)

Find related products by research area.

Blogs on DDX41

There are no specific blogs for DDX41, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455
ELISA: DDX41 Antibody (2F4) [H00051428-M01] - Detection limit for recombinant GST tagged DDX41 is approximately 0.3ng/ml as a capture antibody.
DDX41 Antibody (2F4)
H00051428-M01

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DDX41 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DDX41