![Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607] - Western blot analysis of extracts of various cell lines, using DDX17 Rabbit mAb (NBP3-16607) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/DDX17-Antibody-2U1P0-Western-Blot-NBP3-16607-img0004.jpg "Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607] - Western blot analysis of extracts of various cell lines, using DDX17 Rabbit mAb (NBP3-16607) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 2U1P0 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human DDX17 (Q92841). RGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQ |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | DDX17 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DDX17 Antibody (NBP3-16607)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DDX17 |
![Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607] - Western blot analysis of extracts of various cell lines, using DDX17 Rabbit mAb (NBP3-16607) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/DDX17-Antibody-2U1P0-Western-Blot-NBP3-16607-img0005.jpg "Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607] - Western blot analysis of extracts of various cell lines, using DDX17 Rabbit mAb (NBP3-16607) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
![Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded rat spleen tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16607_rabbit-ddx17-mab-2u1p0-7220251245349.jpg "Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded rat spleen tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse intestin tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16607_rabbit-ddx17-mab-2u1p0-72202512443388.jpg "Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse intestin tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse testis tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16607_rabbit-ddx17-mab-2u1p0-72202512435383.jpg "Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse testis tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded rat kidney tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16607_rabbit-ddx17-mab-2u1p0-722025124533.jpg "Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded rat kidney tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded human cervix cancer tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16607_rabbit-ddx17-mab-2u1p0-72202512443310.jpg "Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded human cervix cancer tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse brain tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16607_rabbit-ddx17-mab-2u1p0-722025124536.jpg "Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse brain tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse lung tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16607_rabbit-ddx17-mab-2u1p0-7220251245397.jpg "Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse lung tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded rat brain tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16607_rabbit-ddx17-mab-2u1p0-72202512435394.jpg "Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded rat brain tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry FAK Antibody (495919) [Unconjugated]](https://images.novusbio.com/images2/FAK_MAB4467_Immunohistochemistry_10745.jpg)
![Western Blot FAK Antibody (495919) [Unconjugated]](https://images.novusbio.com/images2/FAK_MAB4467_Western_Blot_6185.jpg)
![Knockout Validated FAK Antibody (495919) [Unconjugated]](https://images.novusbio.com/images2/FAK_MAB4467_Knockout_Validated_22784.jpg)
![Western Blot Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Western_Blot_5256.jpg)
![Simple Western Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Simple_Western_21252.jpg)
![Immunocytochemistry Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Immunocytochemistry_9784.jpg)
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")