![Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Analysis in human skin and skeletal muscle tissues using NBP1-88192 antibody. Corresponding CXADR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CXADR-Antibody-Immunohistochemistry-Paraffin-NBP1-88192-img0018.jpg "Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Analysis in human skin and skeletal muscle tissues using NBP1-88192 antibody. Corresponding CXADR RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CXADR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CXADR Antibody (NBP1-88192)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CXADR |
![Western Blot: CXADR Antibody [NBP1-88192] - Analysis in human cell lines Caco-2 and MCF-7. Corresponding CXADR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/CXADR-Antibody-Western-Blot-NBP1-88192-img0014.jpg "Western Blot: CXADR Antibody [NBP1-88192] - Analysis in human cell lines Caco-2 and MCF-7. Corresponding CXADR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: CXADR Antibody [NBP1-88192] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CXADR-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88192-img0010.jpg "Immunocytochemistry/Immunofluorescence: CXADR Antibody [NBP1-88192] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/CXADR-Antibody-Immunohistochemistry-Paraffin-NBP1-88192-img0012.jpg "Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human prostate shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/CXADR-Antibody-Immunohistochemistry-Paraffin-NBP1-88192-img0015.jpg "Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human prostate shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/CXADR-Antibody-Immunohistochemistry-Paraffin-NBP1-88192-img0016.jpg "Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CXADR-Antibody-Immunohistochemistry-Paraffin-NBP1-88192-img0017.jpg "Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A CD46 Antibody (344519) [Unconjugated]](https://images.novusbio.com/images/antibody/mab2005_human-cd46-mab-clone-344519-209202413163..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")