CHRFAM7A Antibody Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CHRFAM7A (NP_647536.1).
Sequence: MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CHRFAM7A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
46 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CHRFAM7A Antibody
Background
CHRFAM7A is a gene that codes for a multi-pass membrane protein expressed in the hippocampus that is 412 amino acids long and weighs approximately 46 kDa. Current studies are being done on diseases and disorders related to this gene including neuronitis, Alzheimer's disease, juvenile myoclonic epilepsy, bipolar affective disorder, schizoaffective disorder, pharyngitis, and dementia. CHRFAM7A has been shown to have involvement in pathways such as the SIDS susceptibility pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu, Rt
Applications: ELISA, Flow, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for CHRFAM7A Antibody (NBP3-38474) (0)
There are no publications for CHRFAM7A Antibody (NBP3-38474).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHRFAM7A Antibody (NBP3-38474) (0)
There are no reviews for CHRFAM7A Antibody (NBP3-38474).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CHRFAM7A Antibody (NBP3-38474) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHRFAM7A Products
Blogs on CHRFAM7A