![Western Blot: CGI-16 Antibody (4E4) [H00023597-M01] - ACATE2 monoclonal antibody (M01), clone 4E4 Analysis of ACATE2 expression in MCF-7.](http://images.novusbio.com/fullsize/CGI-16-Antibody-4E4-Western-Blot-H00023597-M01-img0009.jpg "Western Blot: CGI-16 Antibody (4E4) [H00023597-M01] - ACATE2 monoclonal antibody (M01), clone 4E4 Analysis of ACATE2 expression in MCF-7.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 4E4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ACATE2 (AAH12573, 1 a.a. ~ 212 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG |
| Specificity | ACOT9 - acyl-Coenzyme A thioesterase 2, mitochondrial |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ACOT9 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Western_Blot_16272.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16281.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16416.jpg)
| Publication using H00023597-M01 | Applications | Species |
|---|---|---|
| Cieniewski-Bernard C, Mulder P, Henry JP et al. Proteomic Analysis of Left Ventricular Remodeling in an Experimental Model of Heart Failure. J Proteome Res. 2008-10-16 [PMID: 18922030] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CGI-16 Antibody (4E4) [H00023597-M01] - Analysis of monoclonal antibody to ACOT9 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/CGI-16-Antibody-4E4-Immunocytochemistry-Immunofluorescence-H00023597-M01-img0005.jpg "Immunocytochemistry/Immunofluorescence: CGI-16 Antibody (4E4) [H00023597-M01] - Analysis of monoclonal antibody to ACOT9 on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: CGI-16 Antibody (4E4) [H00023597-M01] - Analysis of monoclonal antibody to ACOT9 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/CGI-16-Antibody-4E4-Immunohistochemistry-Paraffin-H00023597-M01-img0007.jpg "Immunohistochemistry-Paraffin: CGI-16 Antibody (4E4) [H00023597-M01] - Analysis of monoclonal antibody to ACOT9 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.")
![Western Blot: CGI-16 Antibody (4E4) [H00023597-M01] - Analysis of ACOT9 expression in transfected 293T cell line by ACATE2 monoclonal antibody (M01), clone 4E4.Lane 1: ACOT9 transfected lysate(24 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CGI-16-Antibody-4E4-Western-Blot-H00023597-M01-img0010.jpg "Western Blot: CGI-16 Antibody (4E4) [H00023597-M01] - Analysis of ACOT9 expression in transfected 293T cell line by ACATE2 monoclonal antibody (M01), clone 4E4.Lane 1: ACOT9 transfected lysate(24 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: CGI-16 Antibody (4E4) [H00023597-M01] - Detection limit for recombinant GST tagged ACOT9 is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CGI-16-Antibody-4E4-Sandwich-ELISA-H00023597-M01-img0008.jpg "Sandwich ELISA: CGI-16 Antibody (4E4) [H00023597-M01] - Detection limit for recombinant GST tagged ACOT9 is approximately 3ng/ml as a capture antibody.")
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")