Home » Carboxypeptidase M » Carboxypeptidase M Proteins » Carboxypeptidase M Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Carboxypeptidase M Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Carboxypeptidase M Protein (NBP1-87403PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Carboxypeptidase M Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CPM.

Source: E. coli

Amino Acid Sequence: LKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CPM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87403.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carboxypeptidase M Recombinant Protein Antigen

  • Carboxypeptidase M
  • CPM
  • EC 3.4.17
  • EC 3.4.17.12

Background

The protein encoded by the Carboxypeptidase M gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Adrenomedullin/ADM
Antibody [Unconjugate ...
AF6108
Immunohistochemistry Adrenomedullin/ADM Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC
Kininogen Antibody
NBP1-89993
Immunohistochemistry-Paraffin Kininogen Antibody
Immunohistochemistry-Paraffin Kininogen Antibody
Western Blot Kininogen Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Carboxypeptidase
E/CPE Antibody [Uncon ...
AF3587
Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]
Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]
Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
CPN1 Antibody
NBP3-32212
Western Blot CPN1 Antibody
Immunocytochemistry/ Immunofluorescence CPN1 Antibody
Species: Hu, Mu
Applications: ICC/IF, WB
Neprilysin/CD10
Antibody [Unconjugate
AF1126
Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
DPPIV/CD26
Antibody [Unconjugate
AF1180
Simple Western DPPIV/CD26 Antibody [Unconjugated]
Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]
Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]
(2 Reviews)
(56 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Bradykinin
RB1/BDKRB1 Antibody - ...
NLS799
Immunohistochemistry-Paraffin Bradykinin RB1/BDKRB1 Antibody - BSA Free
Immunohistochemistry-Paraffin Bradykinin RB1/BDKRB1 Antibody - BSA Free
Immunohistochemistry-Paraffin Bradykinin RB1/BDKRB1 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Blooms Syndrome
Protein Blm Antibody
NBP1-89929
Immunohistochemistry-Paraffin Blooms Syndrome Protein Blm Antibody
Immunocytochemistry/ Immunofluorescence Blooms Syndrome Protein Blm Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TMEM37 Antibody
NBP2-47602
Immunocytochemistry/ Immunofluorescence TMEM37 Antibody
Immunohistochemistry-Paraffin TMEM37 Antibody
Immunohistochemistry-Paraffin TMEM37 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Carboxypeptidase
A1/CPA1 Antibody
AF2765
Carboxypeptidase A1/CPA1 Antibody
(23 Publications)
Species: Mu
Applications: IP, Neut, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA

Publications for Carboxypeptidase M Protein (NBP1-87403PEP) (0)

There are no publications for Carboxypeptidase M Protein (NBP1-87403PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxypeptidase M Protein (NBP1-87403PEP) (0)

There are no reviews for Carboxypeptidase M Protein (NBP1-87403PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carboxypeptidase M Protein (NBP1-87403PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carboxypeptidase M Products

Blogs on Carboxypeptidase M

There are no specific blogs for Carboxypeptidase M, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carboxypeptidase M Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CPM