![Western Blot: B4GALT7 Antibody [NBP1-88652] - Analysis in human cell line HDLM-2.](http://images.novusbio.com/fullsize/B4GALT7-Antibody-Western-Blot-NBP1-88652-img0005.jpg "Western Blot: B4GALT7 Antibody [NBP1-88652] - Analysis in human cell line HDLM-2.")
| Reactivity | Hu, ChHa, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVG |
| Predicted Species | Mouse (97%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | B4GALT7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Flow_Cytometry_11328.jpg)
![Simple Western Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin1_AF1152_Simple_Western_16673.jpg)
![Immunohistochemistry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Immunohistochemistry_6684.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | B4GALT7 |
![Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/antibody/nbp1-88652_rabbit-polyclonal-b4galt7-antibody-immunohistochemistry-paraffin-1312202383757..jpg "Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/antibody/nbp1-88652_rabbit-polyclonal-b4galt7-antibody-immunohistochemistry-paraffin-1312202383910..jpg "Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/antibody/nbp1-88652_rabbit-polyclonal-b4galt7-antibody-immunohistochemistry-paraffin-1312202384030..jpg "Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-88652_rabbit-polyclonal-b4galt7-antibody-immunohistochemistry-paraffin-1312202384136..jpg "Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Western_Blot_17244.jpg)
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Simple_Western_17469.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Immunohistochemistry_17623.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")