![Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human cerebellum, cerebral cortex, lymph node and pancreas using Anti-B4GALNT1 antibody NBP1-88662 (A) shows similar protein distribution across tissues to independent antibody NBP1-88663 (B).](http://images.novusbio.com/fullsize/B4GALNT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88662-img0018.jpg "Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human cerebellum, cerebral cortex, lymph node and pancreas using Anti-B4GALNT1 antibody NBP1-88662 (A) shows similar protein distribution across tissues to independent antibody NBP1-88663 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | B4GALNT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunocytochemistry__Immunofluorescence_21675.jpg)
![Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunohistochemistry_6763.jpg)
![Knockout Validated HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Knockout_Validated_22522.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | B4GALNT1 |
![Western Blot: B4GALNT1 Antibody [NBP1-88662] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/B4GALNT1-Antibody-Western-Blot-NBP1-88662-img0006.jpg "Western Blot: B4GALNT1 Antibody [NBP1-88662] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/B4GALNT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88662-img0020.jpg "Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Western Blot: B4GALNT1 Antibody [NBP1-88662] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize/B4GALNT1-Antibody-Western-Blot-NBP1-88662-img0005.jpg "Western Blot: B4GALNT1 Antibody [NBP1-88662] - Analysis in human cell line A-549.")
![Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/B4GALNT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88662-img0015.jpg "Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/B4GALNT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88662-img0017.jpg "Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human lymph node shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/B4GALNT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88662-img0019.jpg "Immunohistochemistry-Paraffin: B4GALNT1 Antibody [NBP1-88662] - Staining of human lymph node shows no positivity in germinal center cells as expected.")
![Immunohistochemistry FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Immunohistochemistry_6835.jpg)
![Knockout Validated FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Knockout_Validated_22783.jpg)
![Western Blot FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/af4467_human-mouse-rat-fak-affinity-purified-polyclonal-ab-western-blot-116202015471.jpg)
![Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images2/Pax3_MAB2457_Immunocytochemistry__Immunofluorescence_20313.jpg)
![Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images/mab2457_human-mouse-pax3-pax7-mab-clone-274212-41202412512639.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")