![Western Blot: AS3MT Antibody [H00057412-B01P-50ug] - Analysis of AS3MT expression in human spleen.](http://images.novusbio.com/fullsize/AS3MT-Antibody-Western-Blot-H00057412-B01P-50ug-img0002.jpg "Western Blot: AS3MT Antibody [H00057412-B01P-50ug] - Analysis of AS3MT expression in human spleen.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | AS3MT (AAI60057.1, 1 a.a. - 375 a.a.) full-length human protein. MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRCVPDAAGGCCGTKKSC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | AS3MT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Immunogen affinity purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for AS3MT Antibody (H00057412-B01P-50ug)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AS3MT |
| Entrez |
|
| Uniprot |
|
![Western Blot: AS3MT Antibody [H00057412-B01P-50ug] - Analysis of AS3MT expression in transfected 293T cell line by AS3MT MaxPab polyclonal antibody. Lane 1: AS3MT transfected lysate(41.25 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/AS3MT-Antibody-Western-Blot-H00057412-B01P-50ug-img0001.jpg "Western Blot: AS3MT Antibody [H00057412-B01P-50ug] - Analysis of AS3MT expression in transfected 293T cell line by AS3MT MaxPab polyclonal antibody. Lane 1: AS3MT transfected lysate(41.25 KDa). Lane 2: Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")