![Western Blot: ARF1 Antibody [NBP1-58941] - Middle region validated by WB using Fetal lung Lysate at 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/ARF1-Antibody-Western-Blot-NBP1-58941-img0006.jpg "Western Blot: ARF1 Antibody [NBP1-58941] - Middle region validated by WB using Fetal lung Lysate at 0.2-1 ug/ml.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to ARF1(ADP-ribosylation factor 1) The peptide sequence was selected from the middle region of ARF1. Peptide sequence MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARF1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Control |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ARF1 Antibody (NBP1-58941)Find related products by research area.
|
|
Arf1: A New Focus In Cancer Drug Therapy ARF1 (ADP-ribosylation factor 1) is a protein in the ARF gene family that is responsible for vesicular trafficking within the cell through its activation of phospholipase D. It is found in the cells golgi apparatus and its main function is intra-Golgi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ARF1 Antibody [NBP1-58941] - Mouse brain stem cells, 2 ug/ml.](http://images.novusbio.com/fullsize/ARF1-Antibody-Immunohistochemistry-Paraffin-NBP1-58941-img0003.jpg "Immunohistochemistry-Paraffin: ARF1 Antibody [NBP1-58941] - Mouse brain stem cells, 2 ug/ml.")
![Western Blot: ARF1 Antibody [NBP1-58941] - Human Fetal lung Lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/ARF1-Antibody-Western-Blot-NBP1-58941-img0001.jpg "Western Blot: ARF1 Antibody [NBP1-58941] - Human Fetal lung Lysate, concentration 0.2-1 ug/ml.")
![Western Blot: ARF1 Antibody [NBP1-58941] - Rat brain homogenate at 1:500.](http://images.novusbio.com/fullsize/ARF1-Antibody-Western-Blot-NBP1-58941-img0002.jpg "Western Blot: ARF1 Antibody [NBP1-58941] - Rat brain homogenate at 1:500.")
![Western Blot: ARF1 Antibody [NBP1-58941] - Titration: 2 ug/ml Positive Control: Rat brain homogenate](http://images.novusbio.com/fullsize/ARF1-Antibody-Western-Blot-NBP1-58941-img0005.jpg "Western Blot: ARF1 Antibody [NBP1-58941] - Titration: 2 ug/ml Positive Control: Rat brain homogenate")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")