APOBEC3G Recombinant Protein Antigen

Images

 
There are currently no images for APOBEC3G Protein (NBP1-88592PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

APOBEC3G Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APOBEC3G.

Source: E. coli

Amino Acid Sequence: MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APOBEC3G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88592.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for APOBEC3G Recombinant Protein Antigen

  • APOBEC-related cytidine deaminase
  • APOBEC-related protein 9
  • APOBEC-related protein
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
  • ARCD
  • ARP-9
  • bK150C2.7
  • CEM-15
  • CEM15ARP9
  • dJ494G10.1
  • DNA dC->dU-editing enzyme APOBEC-3G
  • EC 3.5.4
  • EC 3.5.4.-
  • EC 3.5.4.5
  • FLJ12740DNA dC->dU editing enzyme
  • MDS019
  • phorbolin-like protein MDS019

Background

APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-39019
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92770
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-00131
Species: Hu
Applications: Flow, PEP-ELISA, WB
NB100-1226
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-22970
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
DDX0390P-100
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
NBP2-43639
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-82648
Species: Hu
Applications: WB
NBP1-06977
Species: Mu
Applications: PEP-ELISA, WB
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for APOBEC3G Protein (NBP1-88592PEP) (0)

There are no publications for APOBEC3G Protein (NBP1-88592PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC3G Protein (NBP1-88592PEP) (0)

There are no reviews for APOBEC3G Protein (NBP1-88592PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for APOBEC3G Protein (NBP1-88592PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APOBEC3G Products

Blogs on APOBEC3G

There are no specific blogs for APOBEC3G, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our APOBEC3G Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC3G